PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G07210.1
Common NameARR21, RR21, T28J14_150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 621aa    MW: 70226.3 Da    PI: 6.3547
Description response regulator 21
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G07210.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like711.9e-22230283155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k++++Wt  LH+ F++a++++ G +kA+Pk+il +m+v+ Lt+e+v+SHLQkYR+
  AT5G07210.1 230 KKKIQWTDSLHDLFLQAIRHI-GLDKAVPKKILAFMSVPYLTRENVASHLQKYRI 283
                  6899*****************.********************************6 PP

2Response_reg73.96e-25181341110
                   EEEESSSHHHHHHHHHHHHHTTC.....EEEE..EESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
  Response_reg   1 vlivdDeplvrellrqalekegy.....eeva..eaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                   v++vdD++++++++ ++l++++y     +e+a  ++dd+++al +lk ++  +Dli++D  mpgm+Gl+l k+i++e  +lp++v+++  +    +e
   AT5G07210.1  18 VMVVDDDHVFLDIMSRMLQHSKYrdpsvMEIAviAVDDPKKALSTLKIQRdnIDLIITDYYMPGMNGLQLKKQITQEFGNLPVLVMSSDTN--KEEE 112
                   89*****************77775555544544699*********9555555************************99*********7776..6689 PP

                   HHHTTESEEEESS--HHHHHHH CS
  Response_reg  89 alkaGakdflsKpfdpeelvka 110
                    l+ Ga++f+ Kp++p +l+k 
   AT5G07210.1 113 SLSCGAMGFIPKPIHPTDLTKI 134
                   9*****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.6E-1451621IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.1E-2815145No hitNo description
SMARTSM004489.3E-2216135IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521725.98E-2516146IPR011006CheY-like superfamily
PROSITE profilePS5011035.2117139IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.8E-2218135IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.27E-2419139No hitNo description
SuperFamilySSF466892.87E-17228287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-22229287IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-25230283IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MASAQSFYNQ SSVLKINVMV VDDDHVFLDI MSRMLQHSKY RDPSVMEIAV IAVDDPKKAL  60
STLKIQRDNI DLIITDYYMP GMNGLQLKKQ ITQEFGNLPV LVMSSDTNKE EESLSCGAMG  120
FIPKPIHPTD LTKIYQFALS NKRNGKSTLS TEQNHKDADV SVPQQITLVP EQADVLKTKR  180
KNCSFKSDSR TVNSTNGSCV STDGSRKNRK RKPNGGPSDD GESMSQPAKK KKIQWTDSLH  240
DLFLQAIRHI GLDKAVPKKI LAFMSVPYLT RENVASHLQK YRIFLRRVAE QGLYSMLSDR  300
GIDSMFRQTH IKEPYFNYYT PSTSWYDTRL NNRSFYSKPV HGFGQSKLLS TTREPVCFNQ  360
MPYNYMNRSS TYEPHRIGSG SNLTLPIQSN LSFPNQPSQN EERRSFFEPP VMANKIAQTS  420
QVLGFGQLGP SAISGHNFNN NMTSRYGSLI PSQPGPSHFS YGMQSFLNNE NVTYNPQPPA  480
NATTQPNLDE LPQLENLNLY NDFGNTSELP YNISNFQFDD NKHQQGEADP TKFELPAAKF  540
STELNHEDDG DWTFVNINQG QSNGETSNTI ASPETNTPIL NINHNQNQGQ DVPEFNDWSF  600
LDPQELVDDD FMNSLFNNDM N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-18229289464ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209231KRKPNGGPSDDGESMSQPAKKKK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184154330.0
Genevisible250612_s_at0.0
Expression AtlasAT5G07210-
AtGenExpressAT5G07210-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mainly expressed in siliques. Also found in germinating seedlings, stems, flowers and roots, but not in rosette leaves. {ECO:0000269|PubMed:15173562, ECO:0000269|Ref.3}.
Functional Description ? help Back to Top
Source Description
TAIRmember of Response Regulator: B- Type
UniProtPutative transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G07210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. {ECO:0000269|Ref.3}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G07210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1636520.0AL163652.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T28J14 (ESSA project).
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196338.10.0response regulator 21
SwissprotQ9LYP50.0ARR21_ARATH; Putative two-component response regulator ARR21
TrEMBLD7M0G70.0D7M0G7_ARALL; Two-component response regulator
STRINGAT5G07210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61131737
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  3. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  4. Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
    In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(2): p. 122-31
    [PMID:12610214]
  5. Heyl A,Schm
    Cytokinin signal perception and transduction.
    Curr. Opin. Plant Biol., 2003. 6(5): p. 480-8
    [PMID:12972049]
  6. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  7. Tajima Y, et al.
    Comparative studies on the type-B response regulators revealing their distinctive properties in the His-to-Asp phosphorelay signal transduction of Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(1): p. 28-39
    [PMID:14749483]
  8. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  9. Kiba T, et al.
    Combinatorial microarray analysis revealing arabidopsis genes implicated in cytokinin responses through the His->Asp Phosphorelay circuitry.
    Plant Cell Physiol., 2005. 46(2): p. 339-55
    [PMID:15695462]
  10. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  11. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  12. Zybailov B, et al.
    Sorting signals, N-terminal modifications and abundance of the chloroplast proteome.
    PLoS ONE, 2008. 3(4): p. e1994
    [PMID:18431481]
  13. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  14. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  15. Hill K, et al.
    Functional characterization of type-B response regulators in the Arabidopsis cytokinin response.
    Plant Physiol., 2013. 162(1): p. 212-24
    [PMID:23482873]