PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G07160.1
Common NameASML3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 150aa    MW: 17147.7 Da    PI: 10.1495
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G07160.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.8e-1051106661
                  HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                    +r ++NR+AA++sR +K ++++ L +++ eL+ e ++L+++l   +++  +l++
  AT5G07160.1  51 ILKRIISNRVAAQKSRWKKVQYLDALVKRSMELQREVSELRSQLAITSEQKRYLEN 106
                  56999************************************999877777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.8E-1242107No hitNo description
SMARTSM003382.0E-1246110IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.26648111IPR004827Basic-leucine zipper domain
PfamPF001701.5E-750107IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-1050105No hitNo description
CDDcd147031.02E-1152102No hitNo description
PROSITE patternPS0003605368IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSFPVVATSF GVSQSGSQAG KKKGGYVNYE VEPGFTIRMR QNIDPTTDPK ILKRIISNRV  60
AAQKSRWKKV QYLDALVKRS MELQREVSEL RSQLAITSEQ KRYLENEQRQ LKECISARVQ  120
HCINSDGVIE EYKTEIERLK TNLAPLSNLT
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453577330.0
Genevisible250641_at1e-137
Expression AtlasAT5G07160-
AtGenExpressAT5G07160-
ATTED-IIAT5G07160-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G07160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G07160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9609740.0AY960974.1 Arabidopsis thaliana activator of spomin LUC3 (ASML3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196333.21e-108Basic-leucine zipper (bZIP) transcription factor family protein
TrEMBLQ56FQ11e-108Q56FQ1_ARATH; Activator of spomin LUC3
STRINGAT5G07160.11e-108(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MalvidsOGEM144181821
Publications ? help Back to Top
  1. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]