PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G07100.2
Common NameMOJ9.27, T28J14_40, WRKY26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 216aa    MW: 24784 Da    PI: 10.2152
Description WRKY DNA-binding protein 26
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G07100.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.4e-322482260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
                 dDgynWrKYGqK+vkgse+prsY++Ct+++C +kkkve+s   ++++ei+Y+g+Hnh+k
  AT5G07100.2 24 DDGYNWRKYGQKQVKGSENPRSYFKCTYPNCLTKKKVETSLVKGQMIEIVYKGSHNHPK 82
                 8********************************************************85 PP

2WRKY105.62.7e-33140198159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+ +dpk v++tYeg+H+h+
  AT5G07100.2 140 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCFVRKHVERAFQDPKSVITTYEGKHKHQ 198
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-281584IPR003657WRKY domain
SuperFamilySSF1182903.53E-261883IPR003657WRKY domain
PROSITE profilePS5081124.8571883IPR003657WRKY domain
SMARTSM007747.1E-352382IPR003657WRKY domain
PfamPF031062.0E-242481IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-36125200IPR003657WRKY domain
SuperFamilySSF1182903.53E-29132200IPR003657WRKY domain
PROSITE profilePS5081136.196135200IPR003657WRKY domain
SMARTSM007741.0E-36140199IPR003657WRKY domain
PfamPF031064.5E-25141198IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MVTQPLPQLD LFKSEIMSSN KTSDDGYNWR KYGQKQVKGS ENPRSYFKCT YPNCLTKKKV  60
ETSLVKGQMI EIVYKGSHNH PKPQSTKRSS STAIAAHQNS SNGDGKDIGE DETEAKRWKR  120
EENVKEPRVV VQTTSDIDIL DDGYRWRKYG QKVVKGNPNP RSYYKCTFTG CFVRKHVERA  180
FQDPKSVITT YEGKHKHQIP TPRRGPVLRL LGKTET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-3724201878Probable WRKY transcription factor 4
1wj2_A5e-3724201878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.50410.0inflorescence| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250666_at0.0
Expression AtlasAT5G07100-
AtGenExpressAT5G07100-
ATTED-IIAT5G07100-
Functional Description ? help Back to Top
Source Description
TAIREncodes WRKY DNA-binding protein 26 (WRKY26).
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250, ECO:0000269|PubMed:21336597}.
Function -- GeneRIF ? help Back to Top
  1. AtWRKY25 and AtWRKY26 were gradually induced during heat and cold treatments, whereas AtWRKY33 was suppressed by heat treatment and induced rapidly during cold stress.
    [PMID: 20709683]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00494DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G07100.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:21336597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32640 (R), AT2G38470 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G63650(R), AT3G55730(R), AT5G60890(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G07100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0263490.0BT026349.1 Arabidopsis thaliana At5g07100 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974746.11e-162WRKY DNA-binding protein 26
RefseqNP_196327.11e-161WRKY DNA-binding protein 26
SwissprotQ9C5T31e-163WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBLQ0V8711e-162Q0V871_ARATH; At5g07100
STRINGAT5G07100.11e-161(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yu D,Chen C,Chen Z
    Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression.
    Plant Cell, 2001. 13(7): p. 1527-40
    [PMID:11449049]
  4. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  5. Sottosanto JB,Gelli A,Blumwald E
    DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression.
    Plant J., 2004. 40(5): p. 752-71
    [PMID:15546358]
  6. Branco-Price C,Kawaguchi R,Ferreira RB,Bailey-Serres J
    Genome-wide analysis of transcript abundance and translation in Arabidopsis seedlings subjected to oxygen deprivation.
    Ann. Bot., 2005. 96(4): p. 647-60
    [PMID:16081496]
  7. Li Y, et al.
    Establishing glucose- and ABA-regulated transcription networks in Arabidopsis by microarray analysis and promoter classification using a Relevance Vector Machine.
    Genome Res., 2006. 16(3): p. 414-27
    [PMID:16424108]
  8. Tosti N, et al.
    Gene expression profiles of O3-treated Arabidopsis plants.
    Plant Cell Environ., 2006. 29(9): p. 1686-702
    [PMID:16913859]
  9. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  10. Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
    ATR and ATM play both distinct and additive roles in response to ionizing radiation.
    Plant J., 2006. 48(6): p. 947-61
    [PMID:17227549]
  11. Dombrecht B, et al.
    MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis.
    Plant Cell, 2007. 19(7): p. 2225-45
    [PMID:17616737]
  12. Zhang Z, et al.
    Dual regulation role of GH3.5 in salicylic acid and auxin signaling during Arabidopsis-Pseudomonas syringae interaction.
    Plant Physiol., 2007. 145(2): p. 450-64
    [PMID:17704230]
  13. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  14. Ciolkowski I,Wanke D,Birkenbihl RP,Somssich IE
    Studies on DNA-binding selectivity of WRKY transcription factors lend structural clues into WRKY-domain function.
    Plant Mol. Biol., 2008. 68(1-2): p. 81-92
    [PMID:18523729]
  15. Fu QT,Yu DQ
    [Expression profiles of AtWRKY25, AtWRKY26 and AtWRKY33 under abiotic stresses.].
    Yi Chuan, 2010. 32(8): p. 848-56
    [PMID:20709683]
  16. Li S,Fu Q,Chen L,Huang W,Yu D
    Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance.
    Planta, 2011. 233(6): p. 1237-52
    [PMID:21336597]
  17. Cheng Y, et al.
    Structural and functional analysis of VQ motif-containing proteins in Arabidopsis as interacting proteins of WRKY transcription factors.
    Plant Physiol., 2012. 159(2): p. 810-25
    [PMID:22535423]
  18. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]