PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G06800.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 302aa    MW: 34373.4 Da    PI: 8.0885
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G06800.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.9e-32192246155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWt++LHe+Fve+v++LGG++kAtPk+il+ m+ +gLt+ hvkSHLQkYR+
  AT5G06800.2 192 KTRIRWTQDLHEKFVECVNRLGGADKATPKAILKRMDSDGLTIFHVKSHLQKYRI 246
                  68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-17189246IPR009057Homeodomain-like
PROSITE profilePS5129410.244189249IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-28191247IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23192247IPR006447Myb domain, plants
PfamPF002494.7E-9196245IPR001005SANT/Myb domain
PfamPF143798.4E-9276298IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025281anatomypollen
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MMDNINFEFS NASQGSRLQL QQQPPQPFNL QDLNMIQYNQ PSSPWTTETF SGLTPYDCTA  60
NQSFPVQCSS SKPYPSSFHP YHHQSSDSPS LDQSVSMIPM QPLPDQYMKP LYQRSCSNDF  120
AATNASSASY SLSFEASHDP QELCRRTYSN SNVTHLNFTS SQHQPKQSHP RFSSPPSFSI  180
HGGSMAPNCV NKTRIRWTQD LHEKFVECVN RLGGADKATP KAILKRMDSD GLTIFHVKSH  240
LQKYRIAKYM PESQEGKFEK RACAKELSQL DTRTGVQIKE ALQLQLDVQR HLHEQLEVSY  300
KM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-22192249259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453577200.0
Genevisible250697_at0.0
Expression AtlasAT5G06800-
AtGenExpressAT5G06800-
ATTED-IIAT5G06800-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G06800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G06800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2266440.0AK226644.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-39-G11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196298.20.0myb-like HTH transcriptional regulator family protein
SwissprotQ0WVU30.0PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLA0A178UFL50.0A0A178UFL5_ARATH; Uncharacterized protein
STRINGAT5G06800.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  3. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]