PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G06710.1
Common NameHAT14, MPH15.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 336aa    MW: 37603.2 Da    PI: 8.273
Description homeobox from Arabidopsis thaliana
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G06710.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.3e-18189243256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  AT5G06710.1 189 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTK 243
                  678899***********************************************98 PP

2HD-ZIP_I/II128.43e-41189278191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LE+sF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  AT5G06710.1 189 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELR-TL 278
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-17168243IPR009057Homeodomain-like
SuperFamilySSF466894.14E-18181246IPR009057Homeodomain-like
PROSITE profilePS5007116.989185245IPR001356Homeobox domain
SMARTSM003891.5E-16187249IPR001356Homeobox domain
CDDcd000869.17E-16189246No hitNo description
PfamPF000462.3E-15189243IPR001356Homeobox domain
PROSITE patternPS000270220243IPR017970Homeobox, conserved site
SMARTSM003407.2E-26245288IPR003106Leucine zipper, homeobox-associated
PfamPF021837.0E-11245278IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MELALSLGDN TKKQFSFMEK NSKINNPSVS STSTSEKDLG FCMALDVAFG GHRSLSSSSS  60
PSVEDEKKKP APRAKKSDEF RVSSSVDPPL QLQLHFPNWL PENSKGRQGG RMPLGAATVV  120
EEEEEEEEAV PSMSVSPPDS VTSSFQLDFG IKSYGYERRS NKRDIDDEVE RSASRASNED  180
NDDENGSTRK KLRLSKDQSA FLEDSFKEHS TLNPKQKIAL AKQLNLRPRQ VEVWFQNRRA  240
RTKLKQTEVD CEYLKRCCES LTEENRRLQK EVKELRTLKT STPFYMQLPA TTLTMCPSCE  300
RVATSAAQPS TSAAHNLCLS TSSLIPVKPR PAKQVS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1187193TRKKLRL
2237245RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.3570.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250694_at0.0
Expression AtlasAT5G06710-
AtGenExpressAT5G06710-
ATTED-IIAT5G06710-
Functional Description ? help Back to Top
Source Description
TAIRHomeobox-leucine zipper protein.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G06710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G47370
IntActSearch P46665
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G06710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274230.0AK227423.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL14-07-H22.
GenBankAJ4311820.0AJ431182.2 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT14 (hat14 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196289.20.0homeobox-leucine zipper protein HAT14
SwissprotP466650.0HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLD7LZT30.0D7LZT3_ARALL; Homeobox-leucine zipper protein 14
STRINGAT5G06710.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MalvidsOGEM49282852
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Schena M,Davis RW
    HD-Zip proteins: members of an Arabidopsis homeodomain protein superfamily.
    Proc. Natl. Acad. Sci. U.S.A., 1992. 89(9): p. 3894-8
    [PMID:1349174]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  7. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]