PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G06100.1
Common NameATMYB33, MYB33
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 451aa    MW: 51010.8 Da    PI: 5.447
Description myb domain protein 33
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G06100.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-163481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v+++G g+W+++ ++  + R++k+c++rw ++l
      AT5G06100.1 34 KGPWSSAEDDILIDYVNKHGEGNWNAVQKHTSLFRCGKSCRLRWANHL 81
                     79******************************************9986 PP

2Myb_DNA-binding53.94.3e-1787130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
      AT5G06100.1  87 KGAFSQEEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 130
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.832981IPR017930Myb domain
SuperFamilySSF466891.65E-2932128IPR009057Homeodomain-like
SMARTSM007175.0E-143383IPR001005SANT/Myb domain
PfamPF002491.5E-143481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-233588IPR009057Homeodomain-like
CDDcd001676.08E-113681No hitNo description
PROSITE profilePS5129426.31682136IPR017930Myb domain
SMARTSM007172.7E-1786134IPR001005SANT/Myb domain
PfamPF002498.4E-1687130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2589135IPR009057Homeodomain-like
CDDcd001671.19E-1289130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0009908Biological Processflower development
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009066anatomyanther
PO:0009067anatomyfilament
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MSYTSTDSDH NESPAADDNG SDCRSRWDGH ALKKGPWSSA EDDILIDYVN KHGEGNWNAV  60
QKHTSLFRCG KSCRLRWANH LRPNLKKGAF SQEEEQLIVE LHAKMGNRWA RMAAHLPGRT  120
DNEIKNYWNT RIKRRQRAGL PLYPPEMHVE ALEWSQEYAK SRVMGEDRRH QDFLQLGSCE  180
SNVFFDTLNF TDMVPGTFDL ADMTAYKNMG NCASSPRYEN FMTPTIPSSK RLWESELLYP  240
GCSSTIKQEF SSPEQFRNTS PQTISKTCSF SVPCDVEHPL YGNRHSPVMI PDSHTPTDGI  300
VPYSKPLYGA VKLELPSFQY SETTFDQWKK SSSPPHSDLL DPFDTYIQSP PPPTGGEESD  360
LYSNFDTGLL DMLLLEAKIR NNSTKNNLYR SCASTIPSAD LGQVTVSQTK SEEFDNSLKS  420
FLVHSEMSTQ NADETPPSEL LFTLPSLEIV C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31321355107B-MYB
1h8a_C4e-312313513127MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.286260.0leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250710_at0.0
Expression AtlasAT5G06100-
AtGenExpressAT5G06100-
ATTED-IIAT5G06100-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the myb family of transcription factors (MYB33), contains Pfam profile: PF00249 myb DNA-binding domain. Double mutants with MYB65 are male sterile- anthers are small, pollen development is defective. Spatial expression appears to be under the control of miR159, contains a target site for this micro RNA. When the target site is mutated , expression is detected in leaves, roots, anther filament, pistil. The expression of a translational fusion is specific to anther locules in contrast to constructs lacking the miR159 target site. Phenotype is conditional and can be restored by lower temperature or higher light intensity.
Function -- GeneRIF ? help Back to Top
  1. Transformation with MYB33 containing the mutated microRNA target had dramatic pleiotrophic developmental defects, suggesting that restricting MYB33 expression, especially in the shoot apices, is essential for proper plant development.
    [PMID: 15722475]
  2. MYB33 and MYB65 play no part in gibberellin-mediated growth or flowering in vegetative tissues.
    [PMID: 20699403]
  3. There may be factors, in addition to complementarity, that control plant miRNA efficacy, such factors appear to be optimised in regards to the endogenous and ancient miR159:MYB33/65 relationship.
    [PMID: 24103298]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G06100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G16910(A), AT5G61850(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, gibberellin
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G06100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0060490.0BT006049.1 Arabidopsis thaliana clone U51311 putative MYB family transcription factor (At5g06100) mRNA, complete cds.
GenBankAY5196160.0AY519616.1 Arabidopsis thaliana MYB transcription factor (At5g06100) mRNA, complete cds.
GenBankAK1189370.0AK118937.1 Arabidopsis thaliana At5g06100 mRNA for putative transcription factor MYB33, complete cds, clone: RAFL21-27-I01.
GenBankAF4119690.0AF411969.1 Arabidopsis thaliana putative transcription factor MYB33 (MYB33) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196228.10.0myb domain protein 33
TrEMBLQ9LHS60.0Q9LHS6_ARATH; MYB family transcription factor-like
STRINGAT5G06100.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Gocal GF, et al.
    GAMYB-like genes, flowering, and gibberellin signaling in Arabidopsis.
    Plant Physiol., 2001. 127(4): p. 1682-93
    [PMID:11743113]
  4. Moon J, et al.
    The SOC1 MADS-box gene integrates vernalization and gibberellin signals for flowering in Arabidopsis.
    Plant J., 2003. 35(5): p. 613-23
    [PMID:12940954]
  5. Han MH,Goud S,Song L,Fedoroff N
    The Arabidopsis double-stranded RNA-binding protein HYL1 plays a role in microRNA-mediated gene regulation.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(4): p. 1093-8
    [PMID:14722360]
  6. Achard P,Herr A,Baulcombe DC,Harberd NP
    Modulation of floral development by a gibberellin-regulated microRNA.
    Development, 2004. 131(14): p. 3357-65
    [PMID:15226253]
  7. Yoo BC, et al.
    A systemic small RNA signaling system in plants.
    Plant Cell, 2004. 16(8): p. 1979-2000
    [PMID:15258266]
  8. Souret FF,Kastenmayer JP,Green PJ
    AtXRN4 degrades mRNA in Arabidopsis and its substrates include selected miRNA targets.
    Mol. Cell, 2004. 15(2): p. 173-83
    [PMID:15260969]
  9. Millar AA,Gubler F
    The Arabidopsis GAMYB-like genes, MYB33 and MYB65, are microRNA-regulated genes that redundantly facilitate anther development.
    Plant Cell, 2005. 17(3): p. 705-21
    [PMID:15722475]
  10. Kidner CA,Martienssen RA
    The role of ARGONAUTE1 (AGO1) in meristem formation and identity.
    Dev. Biol., 2005. 280(2): p. 504-17
    [PMID:15882589]
  11. Li F,Wu X,Tsang E,Cutler AJ
    Transcriptional profiling of imbibed Brassica napus seed.
    Genomics, 2005. 86(6): p. 718-30
    [PMID:16125897]
  12. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  13. Zhang W, et al.
    Regulation of Arabidopsis tapetum development and function by DYSFUNCTIONAL TAPETUM1 (DYT1) encoding a putative bHLH transcription factor.
    Development, 2006. 133(16): p. 3085-95
    [PMID:16831835]
  14. AbuQamar S, et al.
    Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection.
    Plant J., 2006. 48(1): p. 28-44
    [PMID:16925600]
  15. Reyes JL,Chua NH
    ABA induction of miR159 controls transcript levels of two MYB factors during Arabidopsis seed germination.
    Plant J., 2007. 49(4): p. 592-606
    [PMID:17217461]
  16. Wijeratne AJ, et al.
    Differential gene expression in Arabidopsis wild-type and mutant anthers: insights into anther cell differentiation and regulatory networks.
    Plant J., 2007. 52(1): p. 14-29
    [PMID:17666023]
  17. Zentella R, et al.
    Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.
    Plant Cell, 2007. 19(10): p. 3037-57
    [PMID:17933900]
  18. Xing S,Zachgo S
    ROXY1 and ROXY2, two Arabidopsis glutaredoxin genes, are required for anther development.
    Plant J., 2008. 53(5): p. 790-801
    [PMID:18036205]
  19. Kanrar S,Bhattacharya M,Arthur B,Courtier J,Smith HM
    Regulatory networks that function to specify flower meristems require the function of homeobox genes PENNYWISE and POUND-FOOLISH in Arabidopsis.
    Plant J., 2008. 54(5): p. 924-37
    [PMID:18298668]
  20. Kim S, et al.
    Two cap-binding proteins CBP20 and CBP80 are involved in processing primary MicroRNAs.
    Plant Cell Physiol., 2008. 49(11): p. 1634-44
    [PMID:18829588]
  21. Jiang W,Yu D
    Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid.
    BMC Plant Biol., 2009. 9: p. 96
    [PMID:19622176]
  22. Alonso-Peral MM, et al.
    The microRNA159-regulated GAMYB-like genes inhibit growth and promote programmed cell death in Arabidopsis.
    Plant Physiol., 2010. 154(2): p. 757-71
    [PMID:20699403]
  23. Allen RS, et al.
    MicroR159 regulation of most conserved targets in Arabidopsis has negligible phenotypic effects.
    Silence, 2010. 1(1): p. 18
    [PMID:21029441]
  24. Alonso-Peral MM,Sun C,Millar AA
    MicroRNA159 can act as a switch or tuning microRNA independently of its abundance in Arabidopsis.
    PLoS ONE, 2012. 7(4): p. e34751
    [PMID:22511963]
  25. Daszkowska-Golec A, et al.
    Arabidopsis suppressor mutant of abh1 shows a new face of the already known players: ABH1 (CBP80) and ABI4-in response to ABA and abiotic stresses during seed germination.
    Plant Mol. Biol., 2013. 81(1-2): p. 189-209
    [PMID:23196831]
  26. Deveson I,Li J,Millar AA
    MicroRNAs with analogous target complementarities perform with highly variable efficacies in Arabidopsis.
    FEBS Lett., 2013. 587(22): p. 3703-8
    [PMID:24103298]
  27. Jones AM, et al.
    Border control--a membrane-linked interactome of Arabidopsis.
    Science, 2014. 344(6185): p. 711-6
    [PMID:24833385]
  28. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]