PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G04410.1
Common Nameanac078, NAC078, NAC2, NTL11, T32M21.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 567aa    MW: 63510.7 Da    PI: 4.3837
Description NAC domain containing protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G04410.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.3e-5391361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+ + +
  AT5G04410.1   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFKF-DAISVTDIYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN-G 104
                  579**************************9.99**************95347777888*************************************9.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kktLv++kgrap+ge+t+Wvmheyrl
  AT5G04410.1 105 SRVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                  ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-617159IPR003441NAC domain
PROSITE profilePS5100558.5769159IPR003441NAC domain
PfamPF023655.5E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK VCNKPFKFDA ISVTDIYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYSNG SKTNRATEKG YWKTTGKDRE IRNGSRVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLSDED LKKAGVPQEA YVLCRIFQKS GTGPKNGEQY GAPYLEEEWE  180
EDGMTYVPAQ DAFSEGLALN DDVYVDIDDI DEKPENLVVY DAVPILPNYC HGESSNNVES  240
GNYSDSGNYI QPGNNVVDSG GYFEQPIETF EEDRKPIIRE GSIQPCSLFP EEQIGCGVQD  300
ENVVNLESSN NNVFVADTCY SDIPIDHNYL PDEPFMDPNN NLPLNDGLYL ETNDLSCAQQ  360
DDFNFEDYLS FFDDEGLTFD DSLLMGPEDF LPNQEALDQK PAPKELEKEV AGGKEAVEEK  420
ESGEGSSSKQ DTDFKDFDSA PKYPFLKKTS HMLGAIPTPS SFASQFQTKD AMRLHAAQSS  480
GSVHVTAGMM RISNMTLAAD SGMGWSYDKN GNLNVVLSFG VVQQDDAMTA SGSKTGITAT  540
RAMLVFMCLW VLLLSVSFKI VTMVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-44816519174NAC domain-containing protein 19
3swp_C1e-44816519174NAC domain-containing protein 19
3swp_B1e-44816519174NAC domain-containing protein 19
3swp_A1e-44816519174NAC domain-containing protein 19
3swm_D1e-44816519174NAC domain-containing protein 19
3swm_C1e-44816519174NAC domain-containing protein 19
3swm_B1e-44816519174NAC domain-containing protein 19
3swm_A1e-44816519174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.228520.0flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453576270.0
Genevisible250849_at0.0
Expression AtlasAT5G04410-
AtGenExpressAT5G04410-
ATTED-IIAT5G04410-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
TAIRNAC family member, functions as a transcriptional activator, regulates flavonoid biosynthesis under high light.
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Function -- GeneRIF ? help Back to Top
  1. Molecular mechanisms underlying the cold temperature regulation of flowering time of Arabidopsis are controled by NAC2.
    [PMID: 17653269]
  2. ANAC078 protein functions as a transcription factor, and is associated with expression of genes related to flavonoid biosynthesis, leading to the accumulation of anthocyanins, in response to high light stress.
    [PMID: 19887540]
  3. ANAC092 strongly responds to long-term salt stress that triggers senescence.
    [PMID: 20113437]
  4. The transcript levels of 13 proteasome subunit genes, the protein levels of proteasomes, and the activities of the 26S proteasome in ANAC078-overexpressing Arabidopsis plants (Ox-ANAC078) and knockout ANAC078 (KO-ANAC078) mutants, was investigated.
    [PMID: 21889048]
  5. RPX is a negative regulator of leaf organ size. RPX binds to the promoter of genes encoding 26S proteasomal proteins in vivo, resulting in increased gene expression and proteasome activity.
    [PMID: 23252408]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G04410.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:19887540}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G04410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1288590.0AY128859.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
GenBankAY0996090.0AY099609.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196061.10.0NAC family transcriptional activator
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLD7LXI40.0D7LXI4_ARALL; Putative uncharacterized protein
STRINGAT5G04410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1057159
MalvidsOGEM31922762
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Barrier M,Bustamante CD,Yu J,Purugganan MD
    Selection on rapidly evolving proteins in the Arabidopsis genome.
    Genetics, 2003. 163(2): p. 723-33
    [PMID:12618409]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  6. Yoo SY,Kim Y,Kim SY,Lee JS,Ahn JH
    Control of flowering time and cold response by a NAC-domain protein in Arabidopsis.
    PLoS ONE, 2007. 2(7): p. e642
    [PMID:17653269]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  9. Morishita T, et al.
    Arabidopsis NAC transcription factor, ANAC078, regulates flavonoid biosynthesis under high-light.
    Plant Cell Physiol., 2009. 50(12): p. 2210-22
    [PMID:19887540]
  10. Balazadeh S, et al.
    A gene regulatory network controlled by the NAC transcription factor ANAC092/AtNAC2/ORE1 during salt-promoted senescence.
    Plant J., 2010. 62(2): p. 250-64
    [PMID:20113437]
  11. Yabuta Y, et al.
    Identification of recognition sequence of ANAC078 protein by the cyclic amplification and selection of targets technique.
    Plant Signal Behav, 2010. 5(6): p. 695-7
    [PMID:20404498]
  12. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  13. Yabuta Y, et al.
    Involvement of Arabidopsis NAC transcription factor in the regulation of 20S and 26S proteasomes.
    Plant Sci., 2011. 181(4): p. 421-7
    [PMID:21889048]
  14. Nguyen HM, et al.
    An upstream regulator of the 26S proteasome modulates organ size in Arabidopsis thaliana.
    Plant J., 2013. 74(1): p. 25-36
    [PMID:23252408]