PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G03790.1
Common NameATHB51, ATHB-51, F17C15_210, HB51, LMI1, MED24.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 235aa    MW: 26840.2 Da    PI: 9.452
Description homeobox 51
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G03790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-1878130456
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  + ++t+ ql  Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  AT5G03790.1  78 KKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 130
                  45699***********************************************9 PP

2HD-ZIP_I/II116.31.8e-3777167292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kk+rl++ q+++LE+sF+ee kL+++rKv+l+reLglqprq+avWFqnrRAR+k+kqlE+ y++L+++yd +++e+++L++ev++Lr+ l+
  AT5G03790.1  77 KKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHDEVKKLRALLR 167
                  9**************************************************************************************8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.12E-1863134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-1971135IPR009057Homeodomain-like
PROSITE profilePS5007116.64972132IPR001356Homeobox domain
SMARTSM003891.7E-1674136IPR001356Homeobox domain
CDDcd000864.45E-1577133No hitNo description
PfamPF000464.3E-1678130IPR001356Homeobox domain
PRINTSPR000314.2E-5103112IPR000047Helix-turn-helix motif
PROSITE patternPS000270107130IPR017970Homeobox, conserved site
PRINTSPR000314.2E-5112128IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000229anatomyflower meristem
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020128anatomyleaf margin
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEWSTTSNVE NVRVAFMPPP WPESSSFNSL HSFNFDPYAG NSYTPGDTQT GPVISVPESE  60
KIMNAYRFPN NNNEMIKKKR LTSGQLASLE RSFQEEIKLD SDRKVKLSRE LGLQPRQIAV  120
WFQNRRARWK AKQLEQLYDS LRQEYDVVSR EKQMLHDEVK KLRALLRDQG LIKKQISAGT  180
IKVSGEEDTV EISSVVVAHP RTENMNANQI TGGNQVYGQY NNPMLVASSG WPSYP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124132RRARWKAKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.547120.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250915_at0.0
Expression AtlasAT5G03790-
AtGenExpressAT5G03790-
ATTED-IIAT5G03790-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) meristem identity regulator that acts together with LFY to induce CAL expression. It binds to the CAL promoter proximal CAATNATTG element. LMI1 acts primarily downstream of LFY in meristem identity regulation. The interaction between LFY, LMI1 and CAL resembles a feed-forward loop transcriptional network motif. The gene also had additional LFY-independent roles in leaf morphogenesis and bract formation.
UniProtPutative transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. The LATE MERISTEM IDENTITY1 (LMI1) homeodomain protein regulates stipule proportions via an endoreduplication-dependent trade-off that limits tissue size despite increasing cell growth.
    [PMID: 30366902]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G03790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT5G61850 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G26310(A)
Phenotype -- Mutation ? help Back to Top
Source ID