PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G01380.1
Common NameGT3A, GT-3A, T10O8.90
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 323aa    MW: 38272.7 Da    PI: 6.523
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G01380.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.93.5e-2551133186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ +e+++L+++r+e+++++ ++k++k lWe v++km+++gf rs++qCk+kw+nl +ryk+++++e +     ++++p++++++
  AT5G01380.1  51 QWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKWKNLVTRYKACETTEPDA---IRQQFPFYNEIQ 133
                  7********************************************************************95...56689***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-448110IPR001005SANT/Myb domain
CDDcd122031.27E-2150112No hitNo description
PfamPF138379.8E-2151135No hitNo description
PROSITE profilePS500908.00252108IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MDRRNPFQHH HHHHQLHHHL IQQQQLPPPP LSTTATMDPG GGGGGGERIP QWSIEETKEL  60
LAIREELDQT FMETKRNKLL WEVVAAKMAD KGFVRSAEQC KSKWKNLVTR YKACETTEPD  120
AIRQQFPFYN EIQSIFEARM QRMLWSEATE PSTSSKRKHH QFSSDDEEEE VDEPNQDINE  180
ELLSLVETQK RETEVITTST STNPRKRAKK GKGVASGTKA ETAGNTLKDI LEEFMRQTVK  240
MEKEWRDAWE MKEIEREKRE KEWRRRMAEL EEERAATERR WMEREEERRL REEARAQKRD  300
SLIDALLNRL NRDHNDDHHN QGF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.335610.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453575110.0
Genevisible251114_at0.0
Expression AtlasAT5G01380-
AtGenExpressAT5G01380-
ATTED-IIAT5G01380-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots and flower buds. {ECO:0000269|PubMed:15044016}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G01380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G01380
IntActSearch Q9SDW0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G01380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0289260.0BT028926.1 Arabidopsis thaliana At5g01380 mRNA, complete cds.
GenBankAY2716770.0AY271677.1 Arabidopsis thaliana transcription factor GT-3a (GT3A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195758.10.0trihelix transcription factor GT-3a
SwissprotQ9SDW00.0TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A078CVB91e-154A0A078CVB9_BRANA; BnaC03g00290D protein
TrEMBLA0A0D3AZB11e-154A0A0D3AZB1_BRAOL; Uncharacterized protein
STRINGAT5G01380.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
MalvidsOGEM22152870
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ayadi M,Delaporte V,Li YF,Zhou DX
    Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding transcription factors in Arabidopsis.
    FEBS Lett., 2004. 562(1-3): p. 147-54
    [PMID:15044016]
  3. Park HC, et al.
    Pathogen- and NaCl-induced expression of the SCaM-4 promoter is mediated in part by a GT-1 box that interacts with a GT-1-like transcription factor.
    Plant Physiol., 2004. 135(4): p. 2150-61
    [PMID:15310827]
  4. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  5. Taki N, et al.
    12-oxo-phytodienoic acid triggers expression of a distinct set of genes and plays a role in wound-induced gene expression in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1268-83
    [PMID:16258017]
  6. Yu HJ,Hogan P,Sundaresan V
    Analysis of the female gametophyte transcriptome of Arabidopsis by comparative expression profiling.
    Plant Physiol., 2005. 139(4): p. 1853-69
    [PMID:16299181]
  7. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  8. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  9. Gadeyne A, et al.
    The TPLATE adaptor complex drives clathrin-mediated endocytosis in plants.
    Cell, 2014. 156(4): p. 691-704
    [PMID:24529374]