PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G01200.1
Common NameF7J8_180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 267aa    MW: 29845.2 Da    PI: 5.7492
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G01200.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.11.1e-092975346
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqk 46
                      WT+eE +++ +a + l  +    +W++Ia  ++ g+t  +++ r+  
      AT5G01200.1 29 TWTAEENKRFEKALAYLDDKdnleSWSKIADLIP-GKTVADVIKRYKE 75
                     5*****************99**************.**********975 PP

2Myb_DNA-binding47.63.8e-15147191347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+++++ + k++G+g+W+ Ia+ + ++Rt+ q+ s+ qky
      AT5G01200.1 147 PWTEDEHLRFLMGLKKYGKGDWRNIAKSFVTTRTPTQVASHAQKY 191
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-51875IPR009057Homeodomain-like
PROSITE profilePS512937.6912579IPR017884SANT domain
SMARTSM007172.9E-52679IPR001005SANT/Myb domain
PfamPF002496.3E-82975IPR001005SANT/Myb domain
CDDcd001671.86E-72976No hitNo description
SuperFamilySSF466894.56E-92980IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-13138196IPR009057Homeodomain-like
PROSITE profilePS5129420.531140196IPR017930Myb domain
SuperFamilySSF466891.64E-16142195IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17143195IPR006447Myb domain, plants
SMARTSM007177.0E-12144194IPR001005SANT/Myb domain
PfamPF002498.1E-13147191IPR001005SANT/Myb domain
CDDcd001672.19E-10147192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MSSSTMYRGV NMFSPANTNW IFQEVREATW TAEENKRFEK ALAYLDDKDN LESWSKIADL  60
IPGKTVADVI KRYKELEDDV SDIEAGLIPI PGYGGDASSA ANSDYFFGLE NSSYGYDYVV  120
GGKRSSPAMT DCFRSPMPEK ERKKGVPWTE DEHLRFLMGL KKYGKGDWRN IAKSFVTTRT  180
PTQVASHAQK YFLRQLTDGK DKRRSSIHDI TTVNIPDADA SATATTADVA LSPTPANSFD  240
VFLQPNPHYS FASASASSYY NAFPQWS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.276390.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306791550.0
Genevisible251132_at0.0
Expression AtlasAT5G01200-
AtGenExpressAT5G01200-
ATTED-IIAT5G01200-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G01200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G01200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195300.0AY519530.1 Arabidopsis thaliana MYB transcription factor (At5g01200) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195740.10.0Duplicated homeodomain-like superfamily protein
SwissprotQ8S9H76e-74DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ9LFB60.0Q9LFB6_ARATH; Duplicated homeodomain-like superfamily protein
STRINGAT5G01200.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148841619
Representative plantOGRP27517122
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  3. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  6. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  7. Machemer K, et al.
    Interplay of MYB factors in differential cell expansion, and consequences for tomato fruit development.
    Plant J., 2011. 68(2): p. 337-50
    [PMID:21707804]
  8. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]