PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G40060.1
Common NameATHB16, ATHB-16, HB16, T5J17.230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 294aa    MW: 33394.6 Da    PI: 4.8839
Description homeobox protein 16
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G40060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-1859112356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+++++ +q+++Le+ Fe ++++  e++++LA++lgL+ rqV vWFqNrRa++k
  AT4G40060.1  59 KKRRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWK 112
                  5568999**********************************************9 PP

2HD-ZIP_I/II128.92.1e-4158150193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+ +qvk+LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlEkdy +Lk +yd+l+++ ++L++++++L +e+++
  AT4G40060.1  58 EKKRRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKGQYDSLRHNFDSLRRDNDSLLQEISK 150
                  69*************************************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.17E-1851116IPR009057Homeodomain-like
PROSITE profilePS5007116.8654114IPR001356Homeobox domain
SMARTSM003894.3E-1757118IPR001356Homeobox domain
CDDcd000861.82E-1659115No hitNo description
PfamPF000467.1E-1659112IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-2061121IPR009057Homeodomain-like
PRINTSPR000316.7E-68594IPR000047Helix-turn-helix motif
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
PRINTSPR000316.7E-694110IPR000047Helix-turn-helix motif
PfamPF021832.1E-16114155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MKRLSSSDSM CGLISTSTDE QSPRGYGSNY QSMLEGYDED ATLIEEYSGN HHHMGLSEKK  60
RRLKVDQVKA LEKNFELENK LEPERKTKLA QELGLQPRQV AVWFQNRRAR WKTKQLEKDY  120
GVLKGQYDSL RHNFDSLRRD NDSLLQEISK IKAKVNGEED NNNNKAITEG VKEEEVHKTD  180
SIPSSPLQFL EHSSGFNYRR SFTDLRDLLP NSTVVEAGSS DSCDSSAVLN DETSSDNGRL  240
TPPVTVTGGS FLQFVKTEQT EDHEDFLSGE EACGFFSDEQ PPSLHWYSAS DHWT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15863KKRRLK
2106114RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.208630.0bud| flower| root| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306925900.0
Genevisible252829_at0.0
Expression AtlasAT4G40060-
AtGenExpressAT4G40060-
ATTED-IIAT4G40060-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed with a lower level in siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein.
UniProtProbable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development. {ECO:0000269|PubMed:14623244}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G40060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G65310
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G40060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3706200.0AF370620.1 Arabidopsis thaliana homeodomain-like protein (T5J17.230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195716.10.0homeobox protein 16
SwissprotQ940J10.0ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A178V0P30.0A0A178V0P3_ARATH; HB16
STRINGAT4G40060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  3. Ogawa M, et al.
    Gibberellin biosynthesis and response during Arabidopsis seed germination.
    Plant Cell, 2003. 15(7): p. 1591-604
    [PMID:12837949]
  4. Becker JD,Boavida LC,Carneiro J,Haury M,Feij
    Transcriptional profiling of Arabidopsis tissues reveals the unique characteristics of the pollen transcriptome.
    Plant Physiol., 2003. 133(2): p. 713-25
    [PMID:14500793]
  5. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Wang Y, et al.
    The Arabidopsis homeobox gene, ATHB16, regulates leaf development and the sensitivity to photoperiod in Arabidopsis.
    Dev. Biol., 2003. 264(1): p. 228-39
    [PMID:14623244]
  8. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  9. Lechner E, et al.
    MATH/BTB CRL3 receptors target the homeodomain-leucine zipper ATHB6 to modulate abscisic acid signaling.
    Dev. Cell, 2011. 21(6): p. 1116-28
    [PMID:22172674]
  10. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]