PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G39160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 601aa    MW: 67315.1 Da    PI: 4.357
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G39160.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.11.9e-08446487144
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      r rW++e+ el++++++++G++  + I + ++  Rt++q k+++
      AT4G39160.1 446 RTRWSKEDTELFYEGIQEFGSN-LSMIQQLFP-ERTREQMKLKF 487
                      78******************99.*********.******99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159638.8E-26439523No hitNo description
SuperFamilySSF466895.68E-9440494IPR009057Homeodomain-like
PROSITE profilePS512939.562444495IPR017884SANT domain
SMARTSM007171.0E-6445493IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-6446487IPR009057Homeodomain-like
CDDcd001674.58E-5448488No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDLDFDDQPS DHAAPAVRAG ARFKPKGRPQ PKKKQVSLST TQTTLSPDVA QEKLSTQSED  60
LVPLDGSSEI PSNALPSETN VPDSGSINKS TIGTLSEENE DAFPRGVHWS VKPSILRACN  120
NVNLVGNRRD DGIEATTSFP DDPRTQDSAI FGDYVTPETG ADEGRVDMET LDIVQEEGTT  180
SSYVQHTGKL QPKPRLLETV VEEPEPHYSA GDTGYFPMGT NESEFMANVE SRNGFSTYED  240
LQEEELNIPE APRETVGEME AQNASGGWEQ EEQGVSPCIN NTVTGEEENC MGNTVEEQSK  300
RESKTGKSKR ATSRKRKKTS EEPNKSSEKT EQKKFKHSSR RQKRTLEKEL LETPDHEIRS  360
LPLRDMLRLV EYKEWMQKKE AKGAGVQPSQ ESNNMNGSGS QYHSQGFDEE DEFGDFGIES  420
SEYQENNVVK PDSPVNYQTY MNKTSRTRWS KEDTELFYEG IQEFGSNLSM IQQLFPERTR  480
EQMKLKFKLE ERRNPLKLND ALSSRSKHFT HFKNVIKKLQ QEAAAAKEGE EEEEAGAEAE  540
TTDVPENEEP EKSEETERAS DGVAAGVKES DGGDVENGVR SDGGDECDDD EDFWNSYKSD  600
M
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313317RKRKK
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible252936_at0.0
Expression AtlasAT4G39160-
AtGenExpressAT4G39160-
ATTED-IIAT4G39160-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G39160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G39160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0234410.0BT023441.1 Arabidopsis thaliana At4g39160 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001320166.10.0Homeodomain-like superfamily protein
RefseqNP_195627.20.0Homeodomain-like superfamily protein
TrEMBLA0A384KMK10.0A0A384KMK1_ARATH; Uncharacterized protein
TrEMBLQ700D60.0Q700D6_ARATH; At4g39160
STRINGAT4G39160.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  2. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]