PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G38900.1
Common NameBZIP29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 553aa    MW: 61156.5 Da    PI: 7.1073
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G38900.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.43.7e-094084601163
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++++
  AT4G38900.1 408 LANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMMGLTNQN 460
                  56*************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-16392462IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.62E-10405458No hitNo description
PfamPF001703.1E-7406459IPR004827Basic-leucine zipper domain
CDDcd147038.64E-22406452No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-10406459No hitNo description
PROSITE profilePS502179.553406463IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MGDTEKCNSD MIQRLHSSFG TTSSSIPKNP ISQLDLNPNF IRSSAPQFSK PFSDSGKRIG  60
VPPSHPNLIP PTSPFSQIPT TRQPGSHNFN PGGANHSRSM SQPNSFFSFD SLPPLSPSPF  120
RDHDVSMEDR DSGVFNSNHS LPPSPFTRCN STSSSSLRVG ESLPPRKSHR RSNSDIPSGF  180
NSMPLIPPRP LERSFSGGEC ADWSKSNPFV KKESSCEREG VGEREAMDDL FSAYMNLENI  240
DVLNSSEADD SKNGNENRDD MESSRASGTK TNGSDTEGES SSVNESANNN MNSSGEKRES  300
VKRRAAGGDI APTTRHYRSV SVDSCFMEKL SFGDESLKPP PSPGSMSRKV SPTNSVDGNS  360
GAAFSIEFNN GEFTAAEMKK IMANDKLAEM AMSDPKRVKR NDPLFRILAN RQSAARSKER  420
KMRYIVELEH KVQTLQTEAT TLSAQLTLLQ RDMMGLTNQN NELKFRLQAM EQQARLRDAL  480
NEALNGEVQR LKLAIGESSQ NESERSKMQS LNAEMFQQLN ISQLRQQPQQ MQQQSHQQNH  540
QNGTMATKSE SNE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.28350.0flower| inflorescence| root| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible252969_at0.0
Expression AtlasAT4G38900-
AtGenExpressAT4G38900-
ATTED-IIAT4G38900-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G38900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G43700
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G38900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4012970.0AF401297.1 Arabidopsis thaliana transcription factor bZIP29 (BZIP29) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195601.10.0Basic-leucine zipper (bZIP) transcription factor family protein
TrEMBLQ9T0J70.0Q9T0J7_ARATH; Basic-leucine zipper (BZIP) transcription factor family protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Representative plantOGRP12617181
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Oh K, et al.
    Fine mapping in tomato using microsynteny with the Arabidopsis genome: the Diageotropica (Dgt) locus.
    Genome Biol., 2002. 3(9): p. research0049
    [PMID:12225588]
  4. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  5. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  6. Van Leene J, et al.
    Targeted interactomics reveals a complex core cell cycle machinery in Arabidopsis thaliana.
    Mol. Syst. Biol., 2010. 6: p. 397
    [PMID:20706207]
  7. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  8. Ito J, et al.
    Analysis of the Arabidopsis cytosolic proteome highlights subcellular partitioning of central plant metabolism.
    J. Proteome Res., 2011. 10(4): p. 1571-82
    [PMID:21166475]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  10. Tsugama D,Liu S,Takano T
    Analysis of functions of VIP1 and its close homologs in osmosensory responses of Arabidopsis thaliana.
    PLoS ONE, 2014. 9(8): p. e103930
    [PMID:25093810]