PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G38340.1
Common NameF22I13.110, NLP3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 767aa    MW: 85066.7 Da    PI: 8.1351
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G38340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.42.8e-28495546152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek+i+l++l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  AT4G38340.1 495 AEKDITLDTLRQHFAGSLKDAAKNIGVCPTTLKRICRQNGISRWPSRKIKKV 546
                  589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557816.73E-5350410IPR029016GAF domain-like
PROSITE profilePS5151917.086482566IPR003035RWP-RK domain
PfamPF020423.6E-25499546IPR003035RWP-RK domain
SuperFamilySSF542774.21E-20668761No hitNo description
Gene3DG3DSA:3.10.20.2405.8E-19670757No hitNo description
PROSITE profilePS5174524.592673759IPR000270PB1 domain
SMARTSM006662.2E-25673759IPR000270PB1 domain
PfamPF005644.2E-19674758IPR000270PB1 domain
CDDcd064071.29E-40674758No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006107Biological Processoxaloacetate metabolic process
GO:0006108Biological Processmalate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0050152Molecular Functionomega-amidase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MVGPFKKILH AHNQRFPPSS SSSLDPVVDD SSRKQTRIIL SYLLHLSLSL HITYSLCLLH  60
FFFGSSNPFS PMEESNNSAV VDFPDNFMDQ LLWEECWEEE ATQHDQALSS PSGLKERVAC  120
AMGHLQEVMG ERELLIQLWV PVETRSGRVL STEEQPYSIN TFSQSQSLAL YRDASAGYSF  180
AAEVGSEQLV GLPGRVFLRR MPEWTPDVRF FRKEEYPRIG YARRYQVRAT LALPLFQGTS  240
GNCVAVMEMV TTHRNLEYAS QLSTICHALE AFDLRTSQTS IVPASLKVTS SSSSSSRTEV  300
ASILQGICSS HGLPLAVTWG HQDSSSCLSA LISASYAADH GSRCFLAACS EHHLLGGEGI  360
AGRAFATKKQ CFATDVAIFS KWSYPLSHYA KMFDLHAALA VPILTRGNRT VQFVLELFFP  420
RDCLDIQTHS LTLASQLKLR FQSSPHLMVD DNQIAEEVRD AATPPLTQED PKGKQVSFSF  480
SSASSLENRK RKTKAEKDIT LDTLRQHFAG SLKDAAKNIG VCPTTLKRIC RQNGISRWPS  540
RKIKKVGHSL RKLQVVMDSV EGVQGSLHLA SFYSSFPQLQ SSSSSSFPFI NPTQTVHVPP  600
KSPPSSSGSQ SSSGSSTCCS SEEQQLGGFQ KPALSHPQLL TLSSMHEDQR PVRVTSSLPP  660
LPSATTPRKA KDGMKVKAMF GDSMLRMSLL PHSRLTDLRR EIAKRFGMDD VLRSNFSLKY  720
LDDDQEWVLL TCDADLEECI QVYKSSSLKE TIRILVHHPL SRPSFGS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184202200.0
Genevisible253036_at0.0
Expression AtlasAT4G38340-
AtGenExpressAT4G38340-
ATTED-IIAT4G38340-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G38340.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrate. {ECO:0000269|PubMed:15375205}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G38340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0695580.0AC069558.5 Genomic Sequence For Arabidopsis thaliana Clone T5G13 From Chromosome IV, complete sequence.
GenBankAL0355380.0AL035538.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F20D10 (ESSA project).
GenBankAL0355390.0AL035539.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F22I13 (ESSA project).
GenBankAL1615930.0AL161593.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 89.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195547.10.0Plant regulator RWP-RK family protein
SwissprotQ9SVF10.0NLP3_ARATH; Protein NLP3
TrEMBLA0A1P8B7T20.0A0A1P8B7T2_ARATH; Plant regulator RWP-RK family protein
STRINGAT4G38340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152871718
Representative plantOGRP2991697
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  4. Kong H, et al.
    Patterns of gene duplication in the plant SKP1 gene family in angiosperms: evidence for multiple mechanisms of rapid gene birth.
    Plant J., 2007. 50(5): p. 873-85
    [PMID:17470057]
  5. Doidy J, et al.
    "Hit-and-Run" transcription: de novo transcription initiated by a transient bZIP1 "hit" persists after the "run".
    BMC Genomics, 2016. 17: p. 92
    [PMID:26843062]