PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G38000.1
Common NameDOF4.7, F20D10.120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 246aa    MW: 27393.7 Da    PI: 9.6805
Description DNA binding with one finger 4.7
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G38000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.42.3e-363895360
       zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                 +  lkcprCds ntkfCyynnyslsqPr++Ck+CrryWt+GGalrnvP+Gg++r+++k
  AT4G38000.1 38 QPVLKCPRCDSVNTKFCYYNNYSLSQPRHYCKNCRRYWTRGGALRNVPIGGSTRNKNK 95
                 56789*************************************************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-313595IPR003851Zinc finger, Dof-type
PfamPF027015.8E-324095IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2484195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010227Biological Processfloral organ abscission
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009067anatomyfilament
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MMTSSHQSNT TGFKPRRIKT TAKPPRQINN KEPSPATQPV LKCPRCDSVN TKFCYYNNYS  60
LSQPRHYCKN CRRYWTRGGA LRNVPIGGST RNKNKPCSLQ VISSPPLFSN GTSSASRELV  120
RNHPSTAMMM MSSGGFSGYM FPLDPNFNLA SSSIESLSSF NQDLHQKLQQ QRLVTSMFLQ  180
DSLPVNEKTV MFQNVELIPP STVTTDWVFD RFATGGGATS GNHEDNDDGE GNLGNWFHNA  240
NNNALL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.27380.0bud| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253018_at0.0
Expression AtlasAT4G38000-
AtGenExpressAT4G38000-
ATTED-IIAT4G38000-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. AtDOF4.7 participates in the control of abscission as part of the transcription complex that directly regulates the expression of cell wall hydrolysis enzymes.
    [PMID: 20466844]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00478DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G38000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G38000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankBT0060920.0BT006092.1 Arabidopsis thaliana clone U20996 putative Dof zinc finger protein (At4g38000) mRNA, complete cds.
GenBankBT0057670.0BT005767.1 Arabidopsis thaliana clone RAFL15-43-I22 (R20996) putative Dof zinc finger protein (At4g38000) mRNA, complete cds.
GenBankAL1615920.0AL161592.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 88.
GenBankAL0355380.0AL035538.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F20D10 (ESSA project).
GenBankAK2286130.0AK228613.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL15-43-I22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195513.20.0DNA binding with one finger 4.7
SwissprotQ84K520.0DOF47_ARATH; Dof zinc finger protein DOF4.7
TrEMBLQ0WQS40.0Q0WQS4_ARATH; Dof zinc finger protein-like
STRINGAT4G38000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MalvidsOGEM152861518
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  6. Kondou Y, et al.
    RETARDED GROWTH OF EMBRYO1, a new basic helix-loop-helix protein, expresses in endosperm to control embryo growth.
    Plant Physiol., 2008. 147(4): p. 1924-35
    [PMID:18567831]
  7. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  8. Wei PC, et al.
    Overexpression of AtDOF4.7, an Arabidopsis DOF family transcription factor, induces floral organ abscission deficiency in Arabidopsis.
    Plant Physiol., 2010. 153(3): p. 1031-45
    [PMID:20466844]