PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G37940.1
Common NameAGL21, F20D10.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 26411 Da    PI: 9.3404
Description AGAMOUS-like 21
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G37940.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-261059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 ri++++ rqvtfskRr+g++KKA+EL +LCdaev +iifsstgkly+++s
  AT4G37940.1 10 RIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSSTGKLYDFAS 59
                 8***********************************************86 PP

2K-box79.76.9e-2781171999
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  + +++ + +q+e+a L++e++ Lq+++R+++Ge+L+ Ls++eL++Le+q+e sl+ iR +K++ll+++i+el +k + +++en +L++k++
  AT4G37940.1  81 NPASEVKFWQREAAVLRQELHALQENHRQMMGEQLNGLSVNELNSLENQIEISLRGIRMRKEQLLTQEIQELSQKRNLIHQENLDLSRKVQ 171
                  567889***********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.02161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-38160IPR002100Transcription factor, MADS-box
CDDcd002656.33E-43278No hitNo description
SuperFamilySSF554559.81E-32288IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2584170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.25486176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000016anatomylateral root primordium
PO:0000026anatomyprimary root tip
PO:0003021anatomycentral root cap of primary root
PO:0005059anatomyroot endodermis
PO:0006081anatomyprimary root apical meristem
PO:0006307anatomyroot procambium
PO:0009005anatomyroot
PO:0020124anatomyroot stele
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRGKIVIQR IDDSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLIIFSS TGKLYDFASS  60
SMKSVIDRYN KSKIEQQQLL NPASEVKFWQ REAAVLRQEL HALQENHRQM MGEQLNGLSV  120
NELNSLENQI EISLRGIRMR KEQLLTQEIQ ELSQKRNLIH QENLDLSRKV QRIHQENVEL  180
YKKAYMANTN GFTHREVAVA DDESHTQIRL QLSQPEHSDY DTPPRANE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-21169169MEF2C
5f28_B3e-21169169MEF2C
5f28_C3e-21169169MEF2C
5f28_D3e-21169169MEF2C
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253014_at0.0
Expression AtlasAT4G37940-
AtGenExpressAT4G37940-
ATTED-IIAT4G37940-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Primarily expressed during lateral root formation and embryogenesis. {ECO:0000269|PubMed:11855641}.
UniprotTISSUE SPECIFICITY: Specifically expressed in root. {ECO:0000269|PubMed:11855641}.
Functional Description ? help Back to Top
Source Description
TAIRencodes a MADS box protein, highly expressed in the root.
UniProtProbable transcription factor.
Function -- GeneRIF ? help Back to Top
  1. AGL21 may be involved in various environmental and physiological signals-mediated lateral root development and growth.
    [PMID: 25122697]
  2. Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression
    [PMID: 28438576]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G37940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G37940, AT5G13790, AT5G15800, AT5G60910, AT5G62165, AT1G69120, AT1G71692
IntActSearch Q9SZJ6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G37940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3369790.0AF336979.1 Arabidopsis thaliana MADS-box protein AGL21 mRNA, complete cds.
GenBankBT0248460.0BT024846.1 Arabidopsis thaliana At4g37940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195507.11e-168AGAMOUS-like 21
SwissprotQ9SZJ61e-169AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLQ29PR01e-167Q29PR0_ARATH; At4g37940
STRINGAT4G37940.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Burgeff C,Liljegren SJ,Tapia-L
    MADS-box gene expression in lateral primordia, meristems and differentiated tissues of Arabidopsis thaliana roots.
    Planta, 2002. 214(3): p. 365-72
    [PMID:11855641]
  3. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  6. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  7. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  8. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  9. Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG
    Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana.
    Planta, 2005. 222(4): p. 730-42
    [PMID:16021502]
  10. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  11. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  12. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  13. Zhou C,Yin Y,Dam P,Xu Y
    Identification of novel proteins involved in plant cell-wall synthesis based on protein-protein interaction data.
    J. Proteome Res., 2010. 9(10): p. 5025-37
    [PMID:20687615]
  14. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  15. Koizumi K,Wu S,MacRae-Crerar A,Gallagher KL
    An essential protein that interacts with endosomes and promotes movement of the SHORT-ROOT transcription factor.
    Curr. Biol., 2011. 21(18): p. 1559-64
    [PMID:21924907]
  16. Yu LH, et al.
    MADS-box transcription factor AGL21 regulates lateral root development and responds to multiple external and physiological signals.
    Mol Plant, 2014. 7(11): p. 1653-69
    [PMID:25122697]
  17. Yu LH, et al.
    Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression.
    Mol Plant, 2017. 10(6): p. 834-845
    [PMID:28438576]
  18. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]
  19. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]