PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G37790.1
Common NameHAT22, T28I19.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 278aa    MW: 30729.6 Da    PI: 8.1506
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G37790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.9e-18125179256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tk+q   Le+ F+ +++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  AT4G37790.1 125 RKKLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 179
                  788899***********************************************98 PP

2HD-ZIP_I/II121.73.7e-39125214191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+k+q++lLE++F+ +++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke ++L+ +l
  AT4G37790.1 125 RKKLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLK-AL 214
                  69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-17112179IPR009057Homeodomain-like
SuperFamilySSF466896.68E-18120182IPR009057Homeodomain-like
PROSITE profilePS5007116.941121181IPR001356Homeobox domain
SMARTSM003893.5E-14123185IPR001356Homeobox domain
PfamPF000462.9E-15125179IPR001356Homeobox domain
CDDcd000864.48E-15125182No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
SMARTSM003407.7E-26181224IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-9181215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGLDDSCNTG LVLGLGLSPT PNNYNHAIKK SSSTVDHRFI RLDPSLTLSL SGESYKIKTG  60
AGAGDQICRQ TSSHSGISSF SSGRVKRERE ISGGDGEEEA EETTERVVCS RVSDDHDDEE  120
GVSARKKLRL TKQQSALLED NFKLHSTLNP KQKQALARQL NLRPRQVEVW FQNRRARTKL  180
KQTEVDCEFL KKCCETLTDE NRRLQKELQD LKALKLSQPF YMHMPAATLT MCPSCERLGG  240
GGVGGDTTAV DEETAKGAFS IVTKPRFYNP FTNPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.239120.0bud| flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO150280740.0
Genevisible253038_at0.0
Expression AtlasAT4G37790-
AtGenExpressAT4G37790-
ATTED-IIAT4G37790-
Functional Description ? help Back to Top
Source Description
TAIREncodes homeobox protein HAT22, member of the HD-Zip II family.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G37790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDcytokinin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G06710, AT5G47370
IntActSearch P46604
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G37790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0023180.0BT002318.1 Arabidopsis thaliana clone C105403 putative homeobox protein HAT22 (At4g37790) mRNA, complete cds.
GenBankAY0875630.0AY087563.1 Arabidopsis thaliana clone 36691 mRNA, complete sequence.
GenBankATU093360.0U09336.1 Arabidopsis thaliana clone HAT22 homeobox protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195493.10.0homeobox-leucine zipper protein HAT22
SwissprotP466040.0HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLD7MA031e-173D7MA03_ARALL; Homeobox-leucine zipper protein 22
STRINGAT4G37790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Schena M,Davis RW
    HD-Zip proteins: members of an Arabidopsis homeodomain protein superfamily.
    Proc. Natl. Acad. Sci. U.S.A., 1992. 89(9): p. 3894-8
    [PMID:1349174]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  5. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  6. Nemhauser JL,Hong F,Chory J
    Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses.
    Cell, 2006. 126(3): p. 467-75
    [PMID:16901781]
  7. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  8. Jones AM, et al.
    Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana.
    J Proteomics, 2009. 72(3): p. 439-51
    [PMID:19245862]
  9. K
    Ectopic expression of different cytokinin-regulated transcription factor genes of Arabidopsis thaliana alters plant growth and development.
    J. Plant Physiol., 2011. 168(12): p. 1320-7
    [PMID:21453984]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  12. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]