PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G37180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 356aa    MW: 40874.8 Da    PI: 6.6341
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G37180.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-31211265256
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  +r+rW++eLH++Fv+a+++LGG+++AtPk+i++lmkv+gLt+++vkSHLQkYR++
  AT4G37180.1 211 QRRRWSQELHRKFVDALHRLGGPQVATPKQIRDLMKVDGLTNDEVKSHLQKYRMH 265
                  8****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-28207268IPR009057Homeodomain-like
PROSITE profilePS5129413.189207267IPR017930Myb domain
SuperFamilySSF466898.29E-18207268IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-25211265IPR006447Myb domain, plants
PfamPF002496.3E-8212263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MVQTETDQRM GLNLNLSIYS LPKPLSQFLD EVSRIKDNHS KLSEIDGYVG KLEEERNKID  60
VFKRELPLCM LLLNEAIGAL KDEARKGLSL MASNGKFDDV ERAKPETDKK SWMSSAQLWI  120
SNPNSQFRST NEEEEDRCVS QNPFQTCNYP NQGGVFMPFN RPPPPPPPAP LSLMTPTSEM  180
MMDYSRIEQS HHHHQFNKPS SQSHHIQKKE QRRRWSQELH RKFVDALHRL GGPQVATPKQ  240
IRDLMKVDGL TNDEVKSHLQ KYRMHIRKHP LHPTKTLSSS DQPGVLERES QSLISLSRSD  300
SPQSPLVARG LFSSNVGHSS EEDEEEEDEE EEKSDGRSSC RNDETKKKRQ VLDLEL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.46570.0flower| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246215_at0.0
Expression AtlasAT4G37180-
AtGenExpressAT4G37180-
ATTED-IIAT4G37180-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, inflorescence apex, floral primordia, stamen primordia, carpel primordia and ovules. {ECO:0000269|PubMed:26903506}.
Functional Description ? help Back to Top
Source Description
TAIRmyb family transcription factor, contains Pfam domain, PF00249: Myb-like DNA-binding domain l; also isolated as a putative cytoskeletal protein in a yeast screen
UniProtTranscriptional repressor that functions with ULT1 in a pathway which regulates floral meristem homeostasis and organ number in the flower. Binds specifically to the DNA sequence motif 5'-GTAGATTCCT-3' of WUS promoter, and may be involved in direct regulation of WUS expression. Binds specifically to the DNA sequence motif 5'-AAGAATCTTT-3' found in the promoters of AG and the NAC domain genes CUC1, CUC2 and CUC3, and may be involved in direct regulation of these gene expressions.
Function -- GeneRIF ? help Back to Top
  1. UIF1 and ULT1 work together in floral meristem homeostasis, probably by direct repression of WUS expression. [UIF1]
    [PMID: 26903506]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G37180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G37180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0289850.0BT028985.1 Arabidopsis thaliana At4g37180 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568018.10.0Homeodomain-like superfamily protein
SwissprotF4JRB00.0HHO5_ARATH; Transcription factor HHO5
TrEMBLA0A178V7R00.0A0A178V7R0_ARATH; Uncharacterized protein
STRINGAT4G37180.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  4. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Moreau F, et al.
    The Myb-domain protein ULTRAPETALA1 INTERACTING FACTOR 1 controls floral meristem activities in Arabidopsis.
    Development, 2016. 143(7): p. 1108-19
    [PMID:26903506]
  7. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]
  8. Xia G, et al.
    Identification of plant cytoskeletal, cell cycle-related and polarity-related proteins using Schizosaccharomyces pombe.
    Plant J., 1996. 10(4): p. 761-9
    [PMID:8893552]