PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G36870.1
Common NameAP22.90, BLH2, C7A10.490, SAW1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 739aa    MW: 81604.6 Da    PI: 6.7853
Description BEL1-like homeodomain 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G36870.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095185551954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  AT4G36870.1 518 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 555
                  664459******************************88 PP

2BELL122.32e-39376447172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  +r e+q++k+kLl++leeVd+rY++y+eq+q+v++sF++v+g+g+a pYt+lA+ka+SrhFrcLkda+a q+
  AT4G36870.1 376 DRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAMSRHFRCLKDAVAAQL 447
                  589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.0E-82307445IPR006563POX domain
PfamPF075267.6E-49312444IPR006563POX domain
PROSITE profilePS5007112.568496559IPR001356Homeobox domain
CDDcd000862.82E-12499560No hitNo description
SMARTSM003891.2E-9499563IPR001356Homeobox domain
SuperFamilySSF466893.34E-17501566IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-29502565IPR009057Homeodomain-like
PfamPF059203.7E-18516555IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009067anatomyfilament
PO:0009074anatomystyle
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020102anatomyportion of transmitting tissue
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MGITKTSPNT TILLKTFHNN SMSQDYHHHH HHNQHQGGIF NFSNGFDRSD SPNLTTQQKQ  60
EHQRVEMDEE SSVAGGRIPV YESAGMLSEM FNFPGSSGGG RDLDLGQSFR SNRQLLEEQH  120
QNIPAMNATD SATATAAAMQ LFLMNPPPPQ QPPSPSSTTS PRSHHNSSTL HMLLPSPSTN  180
TTHHQNYTNH MSMHQLPHQH HQQISTWQSS PDHHHHHHNS QTEIGTVHVE NSGGHGGQGL  240
SLSLSSSLEA AAKAEEYRNI YYGANSSNAS PHHQYNQFKT LLANSSQHHH QVLNQFRSSP  300
AASSSSMAAV NILRNSRYTT AAQELLEEFC SVGRGFLKKN KLGNSSNPNT CGGDGGGSSP  360
SSAGANKEHP PLSASDRIEH QRRKVKLLTM LEEVDRRYNH YCEQMQMVVN SFDIVMGHGA  420
ALPYTALAQK AMSRHFRCLK DAVAAQLKQS CELLGDKDAA GISSSGLTKG ETPRLRLLEQ  480
SLRQNRAFHQ MGMMEQEAWR PQRGLPERSV NILRAWLFEH FLHPYPSDAD KHLLARQTGL  540
SRNQVSNWFI NARVRLWKPM VEEMYQQESK EREREEELEE NEEDQETKNS NDDKSTKSNN  600
NESNFTAVRT TSQTPTTTAP DASDADAAVA TGHRLRSNIN AYENDASSLL LPSSYSNAAA  660
PAAVSDDLNS RYGGSDAFSA VATCQQSVGG FDDADMDGVN VIRFGTNPTG DVSLTLGLRH  720
AGNMPDKDAS FCVREFGGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-16505563563Homeobox protein Meis2
3k2a_A1e-16505563563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.489460.0floral meristem| inflorescence| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246209_at0.0
Expression AtlasAT4G36870-
AtGenExpressAT4G36870-
ATTED-IIAT4G36870-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in lateral organs. {ECO:0000269|PubMed:17873098}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the BEL family of homeodomain proteins. Plants doubly mutant for saw1/saw2 (blh2/blh4) have serrated leaves. BP is expressed in the serrated leaves, therefore saw1/saw2 may act redundantly to repress BP in leaves.
UniProtTranscription factor that establishes leaf shape by repressing growth in specific subdomains of the leaf. Negatively regulates knox homeobox gene KNAT1/BP expression.
Function -- GeneRIF ? help Back to Top
  1. These data suggest that BLH2/SAW1 and BLH4/SAW2 establish leaf shape by repressing growth in specific subdomains of the leaf at least in part by repressing expression of one or more of the KNOX genes.
    [PMID: 17873098]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G36870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G08150(R)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G25220, AT5G41410, AT1G23380, AT1G26260, AT1G62360, AT1G70510
IntActSearch Q9SW80
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G36870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0504590.0AY050459.1 Arabidopsis thaliana AT4g36870/C7A10_490 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031797.40.0BEL1-like homeodomain protein 2
RefseqNP_195405.40.0BEL1-like homeodomain protein 2
SwissprotQ9SW800.0BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLD7MB330.0D7MB33_ARALL; Putative uncharacterized protein
STRINGAT4G36870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21662466
Representative plantOGRP13316172
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hudson ME,Lisch DR,Quail PH
    The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.
    Plant J., 2003. 34(4): p. 453-71
    [PMID:12753585]
  3. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  6. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  7. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  8. Magnani E,Hake S
    KNOX lost the OX: the Arabidopsis KNATM gene defines a novel class of KNOX transcriptional regulators missing the homeodomain.
    Plant Cell, 2008. 20(4): p. 875-87
    [PMID:18398054]
  9. Kimura S,Koenig D,Kang J,Yoong FY,Sinha N
    Natural variation in leaf morphology results from mutation of a novel KNOX gene.
    Curr. Biol., 2008. 18(9): p. 672-7
    [PMID:18424140]
  10. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]