PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G36780.1
Common NameBEH2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 265aa    MW: 28775.8 Da    PI: 11.3329
Description BES1/BZR1 homolog 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G36780.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822220.34e-68131532145
       DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                  +sgr+ptwkErEnnk+RERrRRai+akiy+GLRaqGnyklpk++DnneVlkALc eAGw+vedDGttyrkg+kp+ ++++ g+ ++ s++ss+q s++
  AT4G36780.1  13 SSGRTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGWIVEDDGTTYRKGFKPP-ASDISGTPTNFSTNSSIQPSPQ 109
                  89*************************************************************************.********************** PP

       DUF822 100 ssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                  ssa++sp++sy+ sp sssfpsps++d ++++    llp+l++ ++
  AT4G36780.1 110 SSAFPSPAPSYHGSPVSSSFPSPSRYDGNPSS--YLLLPFLHNIAS 153
                  *****************************987..899999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.5E-6213137IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MAAGGGGGGG GSSSGRTPTW KERENNKKRE RRRRAITAKI YSGLRAQGNY KLPKHCDNNE  60
VLKALCLEAG WIVEDDGTTY RKGFKPPASD ISGTPTNFST NSSIQPSPQS SAFPSPAPSY  120
HGSPVSSSFP SPSRYDGNPS SYLLLPFLHN IASSIPANLP PLRISNSAPV TPPLSSPTSR  180
GSKRKLTSEQ LPNGGSLHVL RHPLFAISAP SRLVVLVTKR HLQYRNVMSP RRIRSRIQEG  240
GSISNLLLLL HQHLTLFSKL LWPLI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.222850.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402562030.0
Genevisible246284_at0.0
Expression AtlasAT4G36780-
AtGenExpressAT4G36780-
ATTED-IIAT4G36780-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00474DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G36780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDbrassinosteroid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G36780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0973570.0AY097357.1 Arabidopsis thaliana AT4g36780/C7A10_580 mRNA, complete cds.
GenBankAY0503940.0AY050394.1 Arabidopsis thaliana AT4g36780/C7A10_580 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195396.40.0BES1/BZR1-like protein 2
SwissprotQ94A431e-151BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLD7MBE21e-147D7MBE2_ARALL; Putative uncharacterized protein
STRINGAT4G36780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37191024
MalvidsOGEM115122333
Publications ? help Back to Top
  1. Wang ZY, et al.
    Nuclear-localized BZR1 mediates brassinosteroid-induced growth and feedback suppression of brassinosteroid biosynthesis.
    Dev. Cell, 2002. 2(4): p. 505-13
    [PMID:11970900]
  2. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  3. Sottosanto JB,Gelli A,Blumwald E
    DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression.
    Plant J., 2004. 40(5): p. 752-71
    [PMID:15546358]
  4. Yin Y, et al.
    A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.
    Cell, 2005. 120(2): p. 249-59
    [PMID:15680330]
  5. He JX, et al.
    BZR1 is a transcriptional repressor with dual roles in brassinosteroid homeostasis and growth responses.
    Science, 2005. 307(5715): p. 1634-8
    [PMID:15681342]
  6. Rozhon W,Mayerhofer J,Petutschnig E,Fujioka S,Jonak C
    ASKtheta, a group-III Arabidopsis GSK3, functions in the brassinosteroid signalling pathway.
    Plant J., 2010. 62(2): p. 215-23
    [PMID:20128883]
  7. Wang Y, et al.
    Strigolactone/MAX2-induced degradation of brassinosteroid transcriptional effector BES1 regulates shoot branching.
    Dev. Cell, 2013. 27(6): p. 681-8
    [PMID:24369836]