PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G36740.1
Common NameATHB40, ATHB-40, C7A10.620, HB40, HB-5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 216aa    MW: 25079.9 Da    PI: 4.862
Description homeobox protein 40
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G36740.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.4e-2056109457
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  ++++t+eq++ Le  F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  AT4G36740.1  56 KRKLTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKN 109
                  4589************************************************95 PP

2HD-ZIP_I/II124.84.1e-4055145292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kr+l++eqv++LE+sF  e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++d+++ +++rLe+ev +L+e+l 
  AT4G36740.1  55 RKRKLTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEEYNKLKNSHDNVVVDKCRLESEVIQLKEQLY 145
                  8***************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.68250110IPR001356Homeobox domain
SMARTSM003891.0E-1953114IPR001356Homeobox domain
CDDcd000861.95E-1655111No hitNo description
SuperFamilySSF466891.28E-1855120IPR009057Homeodomain-like
PfamPF000461.6E-1756109IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.8E-2157117IPR009057Homeodomain-like
PRINTSPR000319.2E-68190IPR000047Helix-turn-helix motif
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PRINTSPR000319.2E-690106IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020003anatomyplant ovule
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MNYTVDDQNM AFISQLYPDV YTQIVQPGEV KQPKRRRKKT KGSVASADGG NGLFRKRKLT  60
DEQVNMLEMS FGDEHKLESE RKDRLAAELG LDPRQVAVWF QNRRARWKNK RLEEEYNKLK  120
NSHDNVVVDK CRLESEVIQL KEQLYDAERE IQRLAERVEG GSSNSPISSS VSVEANETPF  180
FGDYKVGDDG DDYDHLFYPV PENSYIDEAE WMSLYI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13657RKKTKGSVASADGGNGLFRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.504040.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246279_at0.0
Expression AtlasAT4G36740-
AtGenExpressAT4G36740-
ATTED-IIAT4G36740-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, flowers and siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G36740.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G36740
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615890.0AL161589.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 85.
GenBankAL1615900.0AL161590.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 86.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ997080.0Z99708.1 Arabidopsis thaliana DNA chromosome 4, ESSA I AP2 contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195392.21e-160homeobox protein 40
SwissprotO232081e-161ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A178V0921e-158A0A178V092_ARATH; HB40
STRINGAT4G36740.11e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22082677
Representative plantOGRP37761025
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  3. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  4. Son O, et al.
    Induction of a homeodomain-leucine zipper gene by auxin is inhibited by cytokinin in Arabidopsis roots.
    Biochem. Biophys. Res. Commun., 2005. 326(1): p. 203-9
    [PMID:15567172]
  5. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  6. Saddic LA, et al.
    The LEAFY target LMI1 is a meristem identity regulator and acts together with LEAFY to regulate expression of CAULIFLOWER.
    Development, 2006. 133(9): p. 1673-82
    [PMID:16554366]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  9. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  10. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]