PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G36240.1
Common NameF23E13.130, GATA7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 238aa    MW: 26799.2 Da    PI: 8.3996
Description GATA transcription factor 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G36240.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.49.7e-19166200135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  AT4G36240.1 166 CSHCGVQKTPQWRMGPLGAKTLCNACGVRFKSGRL 200
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-921237IPR016679Transcription factor, GATA, plant
SuperFamilySSF577169.5E-14158222No hitNo description
PROSITE profilePS5011411.292160196IPR000679Zinc finger, GATA-type
SMARTSM004014.6E-14160214IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.9E-14164198IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.5E-16166200IPR000679Zinc finger, GATA-type
PROSITE patternPS003440166191IPR000679Zinc finger, GATA-type
CDDcd002022.29E-14166222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MECVEAFLGD FSVDDLLDLS NADTSLESSS SQRKEDEQER EKFKSFSDQS TRLSPPEDLL  60
SFPGDAPVGD LEDLEWLSNF VEDSFSESYI SSDFPVNPVA SVEVRRQCVP VKPRSKRRRT  120
NGRIWSMESP SPLLSTAVAR RKKRGRQKVD ASYGGVVQQQ QLRRCCSHCG VQKTPQWRMG  180
PLGAKTLCNA CGVRFKSGRL LPEYRPACSP TFTNEIHSNS HRKVLELRLM KVADPARV
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425674500.0
Expression AtlasAT4G36240-
AtGenExpressAT4G36240-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G36240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G36240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1147200.0AY114720.1 Arabidopsis thaliana putative protein (At4g36240) mRNA, complete cds.
GenBankAY0724340.0AY072434.1 Arabidopsis thaliana putative protein (At4g36240) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195347.11e-176GATA transcription factor 7
SwissprotO655151e-178GATA7_ARATH; GATA transcription factor 7
TrEMBLD7MBN21e-136D7MBN2_ARALL; Zinc finger family protein
STRINGAT4G36240.11e-175(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146541720
Representative plantOGRP6817287
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  5. Nakayama N, et al.
    Gene trap lines define domains of gene regulation in Arabidopsis petals and stamens.
    Plant Cell, 2005. 17(9): p. 2486-506
    [PMID:16055634]
  6. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  7. Peng M,Bi YM,Zhu T,Rothstein SJ
    Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA.
    Plant Mol. Biol., 2007. 65(6): p. 775-97
    [PMID:17885809]