PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G36160.1
Common NameANAC076, F23E13.50, NAC076, VND2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 377aa    MW: 43516.8 Da    PI: 6.6098
Description NAC domain containing protein 76
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G36160.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.5e-56101391129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++  ++   e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++ 
  AT4G36160.1  10 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQEscRIGYeERNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD- 105
                  69****************************.9***************953533332556**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  AT4G36160.1 106 KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 139
                  999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-617159IPR003441NAC domain
PROSITE profilePS5100559.58510159IPR003441NAC domain
PfamPF023656.4E-2911138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0071555Biological Processcell wall organization
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000039anatomyshoot axis vascular system
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0003015anatomyprimary root differentiation zone
PO:0005352anatomyxylem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0025275anatomyprocambium
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MESVDQSCSV PPGFRFHPTD EELVGYYLRK KVASQKIDLD VIRDIDLYRI EPWDLQESCR  60
IGYEERNEWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KAVYDKSKLI GMRKTLVFYK  120
GRAPNGQKTD WIMHEYRLES DENAPPQEEG WVVCRAFKKK PMTGQAKNTE TWSSSYFYDE  180
LPSGVRSVTE PLNYVSKQKQ NVFAQDLMFK QELEGSDIGL NFIHCDQFIQ LPQLESPSLP  240
LTKRPVSLTS ITSLEKNKNI YKRHLIEEDV SFNALISSGN KDKKKKKTSV MTTDWRALDK  300
FVASQLMSQE DGVSGFGGHH EEDNNKIGHY NNEESNNKGS VETASSTLLS DREEENRFIS  360
GLLCSNLDYD LYRDLHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-5041609169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425674460.0
Genevisible253076_at0.0
Expression AtlasAT4G36160-
AtGenExpressAT4G36160-
ATTED-IIAT4G36160-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Detected in root protoxylem and metaxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls (PubMed:18445131). Expressed in roots, hypocotyls, cotyledons and leaves. Present in developing xylems (PubMed:16103214, PubMed:16581911). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor. Expressed in the vascular tissue.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00471DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G36160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G13180
IntActSearch O65508
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G36160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1615880.0AL161588.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 84.
GenBankAL0221410.0AL022141.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F23E13 (ESSAII project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195339.10.0NAC domain containing protein 76
SwissprotO655080.0NAC76_ARATH; NAC domain-containing protein 76
TrEMBLD7MBP00.0D7MBP0_ARALL; Putative uncharacterized protein
STRINGAT4G36160.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM36862661
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kubo M, et al.
    Transcription switches for protoxylem and metaxylem vessel formation.
    Genes Dev., 2005. 19(16): p. 1855-60
    [PMID:16103214]
  4. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  5. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  6. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  7. Yamaguchi M,Kubo M,Fukuda H,Demura T
    Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.
    Plant J., 2008. 55(4): p. 652-64
    [PMID:18445131]
  8. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  9. Zhou J,Zhong R,Ye ZH
    Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.
    PLoS ONE, 2014. 9(8): p. e105726
    [PMID:25148240]