PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G35590.1
Common NameF8D20.100, RKD5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 370aa    MW: 43357.8 Da    PI: 9.6238
Description RWP-RK domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G35590.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.91.5e-26240289352
       RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +e+sle+lskyF+l+i +A+++L+v+lTvLK++CR++GI+RWPhRkiksl
  AT4G35590.1 240 AELSLEELSKYFDLTIVEASRNLKVGLTVLKKKCREFGIPRWPHRKIKSL 289
                  789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.508224309IPR003035RWP-RK domain
PfamPF020422.3E-21242289IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MVDQGFFTLK KEKKKNILIK LFYVKILGFC FCDSWSSSDM AHSLTSLAVF QSVIRKEMVR  60
SLHVYESVEI EREFWFKSKS CYVEKKAKPL FRSEDFRRPE ISEGSVFGTW RCIFVFRFNH  120
SLPRFPTLLC LSRNPKLEDI PNLANELKFI SELKPSKIYE EEQCSSSTEG YYNSDLPKPR  180
KLVLKQDLNC LPDSETESEE SVNEKTEHSE FENDKTEQSE SDAKTEILKK KKRTPSRHVA  240
ELSLEELSKY FDLTIVEASR NLKVGLTVLK KKCREFGIPR WPHRKIKSLD CLIHDLQREA  300
EKQQEKNEAA AMAVAKKQEK LETEKRNIVK RPFMEIGIET KKFRQENFKK RHRASRAKKN  360
QESLVTSSST
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184189390.0
Genevisible253146_at0.0
Expression AtlasAT4G35590-
AtGenExpressAT4G35590-
ATTED-IIAT4G35590-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G35590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G35590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0311351e-147AL031135.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F8D20 (ESSAII project).
GenBankAL1615871e-147AL161587.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 83.
GenBankCP0026871e-147CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195284.10.0RWP-RK domain-containing protein
SwissprotO817910.0RKD5_ARATH; Protein RKD5
TrEMBLA0A1P8B4780.0A0A1P8B478_ARATH; RWP-RK domain-containing protein
STRINGAT4G35590.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120492429
Representative plantOGRP5671777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  4. Koszegi D, et al.
    Members of the RKD transcription factor family induce an egg cell-like gene expression program.
    Plant J., 2011. 67(2): p. 280-91
    [PMID:21457369]
  5. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]