PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G35580.2
Common NameCBNAC, NTL9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 534aa    MW: 59721.9 Da    PI: 4.6405
Description NAC transcription factor-like 9
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G35580.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.94.7e-5491351127
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lp GfrF+Ptdeelv++yL+ k++g++ ++ +vi+++d++k+ePwdLp+   +k+++ ew+fF++rd+ky++g+r+nrat+sgyWkatgkd++++s k
  AT4G35580.2   9 LPLGFRFRPTDEELVNHYLRLKINGRHSDV-RVIPDIDVCKWEPWDLPAlsVIKTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKS-K 104
                  699************************999.99***************4447888889**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyr 127
                  ++l+g+kktLvfy+grapkge+t+W+mheyr
  AT4G35580.2 105 KTLIGMKKTLVFYRGRAPKGERTNWIMHEYR 135
                  99****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-644159IPR003441NAC domain
PROSITE profilePS5100558.0369159IPR003441NAC domain
PfamPF023651.2E-2810135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0071470Biological Processcellular response to osmotic stress
GO:1900426Biological Processpositive regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MGAVSMESLP LGFRFRPTDE ELVNHYLRLK INGRHSDVRV IPDIDVCKWE PWDLPALSVI  60
KTDDPEWFFF CPRDRKYPNG HRSNRATDSG YWKATGKDRS IKSKKTLIGM KKTLVFYRGR  120
APKGERTNWI MHEYRPTLKD LDGTSPGQSP YVLCRLFHKP DDRVNGVKSD EAAFTASNKY  180
SPDDTSSDLV QETPSSDAAV EKPSDYSGGC GYAHSNSTAD GTMIEAPEEN LWLSCDLEDQ  240
KAPLPCMDSI YAGDFSYDEI GFQFQDGTSE PDVSLTELLE EVFNNPDDFS CEESISRENP  300
AVSPNGIFSS AKMLQSAAPE DAFFNDFMAF TDTDAEMAQL QYGSEGGASG WPSDTNSYYS  360
DLVQQEQMIN HNTENNLTEG RGIKIRARQP QNRQSTGLIN QGIAPRRIRL QLQSNSEVKE  420
REEVNEGHTV IPEAKEAAAK YSEKSGSLVK PQIKLRARGT IGQVKGERFA DDEKFVVVTG  480
TGAEQKETRR EAMEGGCNGN GGCDGWGRDG YMEDTGEFMT HETQRERERE SNVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-45415912165NO APICAL MERISTEM PROTEIN
1ut4_B2e-45415912165NO APICAL MERISTEM PROTEIN
1ut7_A2e-45415912165NO APICAL MERISTEM PROTEIN
1ut7_B2e-45415912165NO APICAL MERISTEM PROTEIN
3swm_A3e-45415915168NAC domain-containing protein 19
3swm_B3e-45415915168NAC domain-containing protein 19
3swm_C3e-45415915168NAC domain-containing protein 19
3swm_D3e-45415915168NAC domain-containing protein 19
3swp_A3e-45415915168NAC domain-containing protein 19
3swp_B3e-45415915168NAC domain-containing protein 19
3swp_C3e-45415915168NAC domain-containing protein 19
3swp_D3e-45415915168NAC domain-containing protein 19
4dul_A2e-45415912165NAC domain-containing protein 19
4dul_B2e-45415912165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.207440.0bud| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253132_at0.0
Expression AtlasAT4G35580-
AtGenExpressAT4G35580-
ATTED-IIAT4G35580-
Function -- GeneRIF ? help Back to Top
  1. A membrane-associated NAC transcription factor NTL9 may mediate osmotic stress responses that affect leaf senescence, providing a genetic link between intrinsic genetic programs and external signals in the control of leaf senescence.
    [PMID: 18443413]
  2. CBNAC and SNI1 are hypothesized to work together as repressor proteins in the cooperative suppression of plant basal defense.
    [PMID: 22826500]
  3. HopD1 contributes to P. syringae virulence in part by targeting NTL9.
    [PMID: 24329768]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00108PBM26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G35580.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G35580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0564430.0AY056443.1 Arabidopsis thaliana AT4g35580/F8D20_90 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001119122.10.0NAC transcription factor-like 9
SwissprotF4JN350.0NTL9_ARATH; Protein NTM1-like 9
TrEMBLF4JN330.0F4JN33_ARATH; NAC transcription factor-like 9
STRINGAT4G35580.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Representative plantOGRP1172646
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  3. Rizhsky L, et al.
    When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress.
    Plant Physiol., 2004. 134(4): p. 1683-96
    [PMID:15047901]
  4. Ball L, et al.
    Evidence for a direct link between glutathione biosynthesis and stress defense gene expression in Arabidopsis.
    Plant Cell, 2004. 16(9): p. 2448-62
    [PMID:15308753]
  5. Buchanan-Wollaston V, et al.
    Comparative transcriptome analysis reveals significant differences in gene expression and signalling pathways between developmental and dark/starvation-induced senescence in Arabidopsis.
    Plant J., 2005. 42(4): p. 567-85
    [PMID:15860015]
  6. Nakano T, et al.
    Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana.
    J. Plant Res., 2006. 119(4): p. 407-13
    [PMID:16820983]
  7. Kim HS, et al.
    Identification of a calmodulin-binding NAC protein as a transcriptional repressor in Arabidopsis.
    J. Biol. Chem., 2007. 282(50): p. 36292-302
    [PMID:17947243]
  8. Yoon HK,Kim SG,Kim SY,Park CM
    Regulation of leaf senescence by NTL9-mediated osmotic stress signaling in Arabidopsis.
    Mol. Cells, 2008. 25(3): p. 438-45
    [PMID:18443413]
  9. Mukhtar MS, et al.
    Independently evolved virulence effectors converge onto hubs in a plant immune system network.
    Science, 2011. 333(6042): p. 596-601
    [PMID:21798943]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  12. Kim HS, et al.
    A NAC transcription factor and SNI1 cooperatively suppress basal pathogen resistance in Arabidopsis thaliana.
    Nucleic Acids Res., 2012. 40(18): p. 9182-92
    [PMID:22826500]
  13. Block A, et al.
    The Pseudomonas syringae type III effector HopD1 suppresses effector-triggered immunity, localizes to the endoplasmic reticulum, and targets the Arabidopsis transcription factor NTL9.
    New Phytol., 2014. 201(4): p. 1358-70
    [PMID:24329768]