PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G35550.1
Common NameATWOX13, F8D20.60, HB-4, WOX13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 268aa    MW: 29672.9 Da    PI: 5.3537
Description WUSCHEL related homeobox 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G35550.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2097157257
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  r+R+t+t+ ql++Le+ F + + +ps++++++++++l    ++ e++V++WFqNrRa+ k+
  AT4G35550.1  97 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKDITEELsqhgQIAEQNVYNWFQNRRARSKR 157
                  89*****************99**************************************97 PP

2Wus_type_Homeobox103.41.6e-3396159265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i ++NV++WFQNr+aR+++kq
        AT4G35550.1  96 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQIAEQNVYNWFQNRRARSKRKQ 159
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-1792160IPR009057Homeodomain-like
PROSITE profilePS5007114.67393158IPR001356Homeobox domain
SuperFamilySSF466893.89E-1793159IPR009057Homeodomain-like
SMARTSM003895.8E-1495162IPR001356Homeobox domain
PfamPF000462.7E-1897157IPR001356Homeobox domain
CDDcd000862.63E-1297159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000016anatomylateral root primordium
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0005017anatomyflower vascular system
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009062anatomygynoecium
PO:0009073anatomystigma
PO:0020003anatomyplant ovule
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020130anatomycentral root cap
PO:0020131anatomylateral root cap
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MMEWDNQLQP NNHHSSNLQG IDVNGGSGAG GGMYVKVMTD EQYETLRKQI AIYGTICERL  60
VEMHKTLTAQ QDLAGGRMGG LYADPMMSSL GHKMTARQRW TPTPVQLQIL ERIFDQGTGT  120
PSKQKIKDIT EELSQHGQIA EQNVYNWFQN RRARSKRKQH GGGSSGNNNG ESEVETEVEA  180
LNEKRVVRPE SLLGLPDGNS NNNGLGTTTA TTTAPRPEDL CFQSPEISSD LHLLDVLSNP  240
RDEHLVGKMG LAESYNLYDH VEDYGMSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150158RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.24080.0flower| leaf| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453535840.0
Genevisible253131_at0.0
Expression AtlasAT4G35550-
AtGenExpressAT4G35550-
ATTED-IIAT4G35550-
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. WOX13 is the only family member that does not contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. role in regulatory network that orchestrates replum formation in fruit
    [PMID: 22946675]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G35550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G35550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0005380.0BT000538.1 Arabidopsis thaliana homeodomain - like protein (At4g35550/F8D20_60) mRNA, complete cds.
GenBankAY2514040.0AY251404.1 Arabidopsis thaliana WOX13 protein mRNA, complete cds.
GenBankAY0482680.0AY048268.1 Arabidopsis thaliana AT4g35550/F8D20_60 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195280.10.0WUSCHEL-related homeobox 13
SwissprotO817880.0WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLR0GXF71e-165R0GXF7_9BRAS; Uncharacterized protein
STRINGAT4G35550.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18731639
MalvidsOGEM46202851
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  5. Son O, et al.
    Induction of a homeodomain-leucine zipper gene by auxin is inhibited by cytokinin in Arabidopsis roots.
    Biochem. Biophys. Res. Commun., 2005. 326(1): p. 203-9
    [PMID:15567172]
  6. Vanneste S, et al.
    Cell cycle progression in the pericycle is not sufficient for SOLITARY ROOT/IAA14-mediated lateral root initiation in Arabidopsis thaliana.
    Plant Cell, 2005. 17(11): p. 3035-50
    [PMID:16243906]
  7. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  8. Deveaux Y, et al.
    Genes of the most conserved WOX clade in plants affect root and flower development in Arabidopsis.
    BMC Evol. Biol., 2008. 8: p. 291
    [PMID:18950478]
  9. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  10. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  11. Romera-Branchat M,Ripoll JJ,Yanofsky MF,Pelaz S
    The WOX13 homeobox gene promotes replum formation in the Arabidopsis thaliana fruit.
    Plant J., 2013. 73(1): p. 37-49
    [PMID:22946675]