PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G35270.1
Common NameF23E12.170, NLP2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 963aa    MW: 107279 Da    PI: 5.7637
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G35270.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28646696252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek+i le+l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  AT4G35270.1 646 EKTIGLEVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 696
                  799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.041635716IPR003035RWP-RK domain
PfamPF020421.1E-24649696IPR003035RWP-RK domain
SuperFamilySSF542775.33E-24852948No hitNo description
Gene3DG3DSA:3.10.20.2406.3E-25860944No hitNo description
SMARTSM006661.8E-28862945IPR000270PB1 domain
PROSITE profilePS5174529.794862945IPR000270PB1 domain
CDDcd064071.65E-41864944No hitNo description
PfamPF005643.3E-18864944IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 963 aa     Download sequence    Send to blast
MEGGRGGGDG NFLPNSNFGV FSDSAMDMDF MDELLFDGCW LETTDGKSLK QTMGQQVSDS  60
TTMNDNNNNS YLYGYQYAEN LSQDHISNEE TGRKFPPIPP GFLKIEDLSN QVPFDQSAVM  120
SSAQAEKFLL EESEGGRRYW IAPRTSQGPS SSVKERLVQA IEGLNEEVQD KDFLIQIWLP  180
IQQEGKNFLT TSEQPHFFNP KYSSLKRYRD VSVAYNFLAD EDSKESVGLP GRVFLKKLPE  240
WTPDVRFFRS EEYPRIKEAE QCDVRGSLAL PVFERGSGTC LGVVEIVTTT QKMNYRPELD  300
NICKALESVN LRSSRSLNPP SREFLQVYNE FYYAALPEVS EFLTLVCRVY DLPLALTWAP  360
CARQGKVGSR HSDENFSECV STVDDACIVP DHQSRHFLEA CSEHHLLQGE GIVGKAFNAT  420
KLFFVPEVTT FSKTNYPLAH HAKISGLHAA LAVPLKNKFN SSVEFVLEFF FPKACLDTEA  480
QQDMLKSLSA TLQQDFRSLN LFIDKELELE VVFPVREEVV FAENPLINAG TGEDMKPLPL  540
EEISQEDSSW ISHMIKANEK GKGVSLSWEY QKEEPKEEFM LTSGWDNNQI GSGHNNFLSE  600
AEQFQKVTNS GLRIDMDPSF ESASFGVGQT LLGSRRPGEK RRTKTEKTIG LEVLRQYFAG  660
SLKDAAKSIG VCPTTLKRIC RQHGITRWPS RKIKKVGHSL KKLQLVIDSV QGVQGSIQLD  720
SFYTSFPELS SPHMSGTGTS FKNPNAQTEN GVSAQGTAAA PKSPPSSSCS HSSGSSTCCS  780
TGANQSTNTG TTSNTVTTLM AENASAILKR ARSEVRLHTM NQDETKSLSR TLSHKTFSEH  840
PLFENPPRLP ENSSRKLKAG GASKVKATFG EAKVRFTLLP TWGFRELQHE IARRFNIDNI  900
APFDLKYLDD DKEWVLLTCE ADLEECIDIY RSSQSRTIKI SVHEASQVKL GGSFGSIGLG  960
PSL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.219370.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341871800.0
Genevisible253186_at1e-104
Expression AtlasAT4G35270-
AtGenExpressAT4G35270-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G35270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G35270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5799120.0AJ579912.1 Arabidopsis thaliana partial mRNA for NIN-like protein 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001320140.10.0Plant regulator RWP-RK family protein
RefseqNP_001328087.10.0Plant regulator RWP-RK family protein
RefseqNP_001328088.10.0Plant regulator RWP-RK family protein
RefseqNP_195253.40.0Plant regulator RWP-RK family protein
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A178UYT30.0A0A178UYT3_ARATH; Uncharacterized protein
STRINGAT4G35270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19982777
Representative plantOGRP2991697
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]