PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G34990.1
Common NameAtMYB32, M4E13.50, MYB32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 274aa    MW: 31457.6 Da    PI: 8.737
Description myb domain protein 32
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G34990.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k +G g+W++ +r  g+ R++k+c++rw +yl
      AT4G34990.1 14 KGAWTKEEDDKLISYIKAHGEGCWRSLPRSAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.94.9e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
      AT4G34990.1  67 RGNFTLEEDDLIIKLHSLLGNK-WSLIATRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.89961IPR017930Myb domain
SuperFamilySSF466891.09E-2913108IPR009057Homeodomain-like
SMARTSM007174.1E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001676.88E-101661No hitNo description
PROSITE profilePS5129428.26662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2765116IPR009057Homeodomain-like
SMARTSM007172.3E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1667111IPR001005SANT/Myb domain
CDDcd001672.60E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009062anatomygynoecium
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRSPCCEKD HTNKGAWTKE EDDKLISYIK AHGEGCWRSL PRSAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TLEEDDLIIK LHSLLGNKWS LIATRLPGRT DNEIKNYWNT HVKRKLLRKG  120
IDPATHRPIN ETKTSQDSSD SSKTEDPLVK ILSFGPQLEK IANFGDERIQ KRVEYSVVEE  180
RCLDLNLELR ISPPWQDKLH DERNLRFGRV KYRCSACRFG FGNGKECSCN NVKCQTEDSS  240
SSSYSSTDIS SSIGYDFLGL NNTRVLDFST LEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.286790.0flower| inflorescence| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306901760.0
Genevisible253219_at0.0
Expression AtlasAT4G34990-
AtGenExpressAT4G34990-
ATTED-IIAT4G34990-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots, and, to a lower extent, in stems, flower buds, and siliques. {ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G34990.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light, UV, cold, drought, ethylene, jasmonic acid (JA), salicylic acid (SA), abscisic acid (ABA), cadmium (CdCl(2)), high salt (NaCl), and cytokinins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G22880(A), AT5G42800(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G34990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196120.0AY519612.1 Arabidopsis thaliana MYB transcription factor (At4g34990) mRNA, complete cds.
GenBankBT0249070.0BT024907.1 Arabidopsis thaliana At4g34990 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195225.10.0myb domain protein 32
SwissprotO496080.0MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A178UX440.0A0A178UX44_ARATH; MYB32
STRINGAT4G34990.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Preston J,Wheeler J,Heazlewood J,Li SF,Parish RW
    AtMYB32 is required for normal pollen development in Arabidopsis thaliana.
    Plant J., 2004. 40(6): p. 979-95
    [PMID:15584962]
  4. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  7. Oravecz A, et al.
    CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis.
    Plant Cell, 2006. 18(8): p. 1975-90
    [PMID:16829591]
  8. Zhang W, et al.
    Regulation of Arabidopsis tapetum development and function by DYSFUNCTIONAL TAPETUM1 (DYT1) encoding a putative bHLH transcription factor.
    Development, 2006. 133(16): p. 3085-95
    [PMID:16831835]
  9. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  10. Yang C, et al.
    Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.
    Plant Cell, 2007. 19(2): p. 534-48
    [PMID:17329564]
  11. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  12. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  13. Cheng H, et al.
    Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.
    PLoS Genet., 2009. 5(3): p. e1000440
    [PMID:19325888]
  14. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  15. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  16. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  17. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  18. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  19. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  20. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  21. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  22. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]