PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G34610.1
Common NameBLH6, T4L20.190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 532aa    MW: 59609.2 Da    PI: 5.8375
Description BEL1-like homeodomain 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G34610.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-083343711954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  AT4G34610.1 334 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 371
                  664459******************************88 PP

2BELL127.93.7e-41200271172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erqe+q+k +kLls+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFr+L+dai++qi
  AT4G34610.1 200 ERQEMQSKLTKLLSMLDEVDRRYKQYYQQMQIVVSSFDVIAGYGAAKPYTALALQTISRHFRSLRDAISGQI 271
                  79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-77135269IPR006563POX domain
PfamPF075266.1E-49141268IPR006563POX domain
PROSITE profilePS5007111.758312375IPR001356Homeobox domain
SMARTSM003891.0E-8315379IPR001356Homeobox domain
CDDcd000867.48E-11315376No hitNo description
SuperFamilySSF466891.54E-16316381IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-26318380IPR009057Homeodomain-like
PfamPF059201.0E-17332371IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MENYPETQFI PGDSMIQNAI VSYSEESAGR ERRTEANNVS ASQERQALSR FGGVPQMQNI  60
GQDFGSWRDQ ASDRNGFQLM SAMAGATGIL QTGQGLSLSL GSQILPGIHQ ISHQNMAPRG  120
NEYATQSFPG GNQNLDVVRT IPNSKYLKAA QQLLDEAVNV KKALKQFQAE GDKNNENPQE  180
PNQSTQDSST NPPADISQSE RQEMQSKLTK LLSMLDEVDR RYKQYYQQMQ IVVSSFDVIA  240
GYGAAKPYTA LALQTISRHF RSLRDAISGQ ILVLRKCLGE QQDGSDGKRV GIISRLKYVD  300
QHLRQQRGFM QPQAWRPQRG LPENSVLILR AWLFEHFLHP YPKDSDKIML ARQTGLSRGQ  360
VSNWFINARV RLWKPMVEEI YKEEFTENDS NSSSENTPKM SEIGPVAADD EDRAREFSQD  420
QTKPDHGHGY GEETRGMVQG SHMDGRRFMA VEPTYHVADT SRLGRGDVSL TLGLQNSQGQ  480
DNVVAMSSEA YNNFSGVDIY ENAIPGDEME YVNPGSRQNR INSSQLVHDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-15321379563Homeobox protein Meis2
3k2a_B8e-15321379563Homeobox protein Meis2
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865162890.0
Genevisible253247_at0.0
Expression AtlasAT4G34610-
AtGenExpressAT4G34610-
ATTED-IIAT4G34610-
Function -- GeneRIF ? help Back to Top
  1. BLH6 and KNAT7 bind to the REV promoter and repress REV expression.
    [PMID: 25490916]
  2. This study shows that OFP1 and OFP4 enhance the repression activity of BLH6, supporting a role for these OFPs as components of a putative multi-protein transcription regulatory complex containing BLH6 and KNAT7.
    [PMID: 26107719]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G34610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G11060, AT5G25220, AT1G23380, AT1G62360, AT1G62990, AT1G70510
IntActSearch O65685
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G34610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0122910.0BT012291.1 Arabidopsis thaliana At4g34610 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001119116.10.0BEL1-like homeodomain 6
RefseqNP_195187.10.0BEL1-like homeodomain 6
SwissprotO656850.0BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLA0A0R7LJI30.0A0A0R7LJI3_ARATH; BEL1-like homeodomain 6
STRINGAT4G34610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Representative plantOGRP13316172
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  3. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  4. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  5. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  6. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  7. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  8. Liu Y, et al.
    BEL1-LIKE HOMEODOMAIN6 and KNOTTED ARABIDOPSIS THALIANA7 interact and regulate secondary cell wall formation via repression of REVOLUTA.
    Plant Cell, 2014. 26(12): p. 4843-61
    [PMID:25490916]
  9. Liu Y,Douglas CJ
    A role for OVATE FAMILY PROTEIN1 (OFP1) and OFP4 in a BLH6-KNAT7 multi-protein complex regulating secondary cell wall formation in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(7): p. e1033126
    [PMID:26107719]