PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G34000.2
Common NameABF3, AtABF3, BZIP37, DPBF5, F28A23.230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 454aa    MW: 49677 Da    PI: 8.8001
Description abscisic acid responsive elements-binding factor 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G34000.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.33.9e-14374423554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +r++r++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+k+  e+ +
  AT4G34000.2 374 RRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIME 423
                  69*************************************99876555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.4E-14370435IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.473372417IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-10374426No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-13374430No hitNo description
PfamPF001707.6E-12374430IPR004827Basic-leucine zipper domain
CDDcd147076.57E-28374428No hitNo description
PROSITE patternPS000360377392IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MGSRLNFKSF VDGVSEQQPT VGTSLPLTRQ NSVFSLTFDE FQNSWGGGIG KDFGSMNMDE  60
LLKNIWTAEE SHSMMGNNTS YTNISNGNSG NTVINGGGNN IGGLAVGVGG ESGGFFTGGS  120
LQRQGSLTLP RTISQKRVDD VWKELMKEDD IGNGVVNGGT SGIPQRQQTL GEMTLEEFLV  180
RAGVVREEPQ PVESVTNFNG GFYGFGSNGG LGTASNGFVA NQPQDLSGNG VAVRQDLLTA  240
QTQPLQMQQP QMVQQPQMVQ QPQQLIQTQE RPFPKQTTIA FSNTVDVVNR SQPATQCQEV  300
KPSILGIHNH PMNNNLLQAV DFKTGVTVAA VSPGSQMSPD LTPKSALDAS LSPVPYMFGR  360
VRKTGAVLEK VIERRQKRMI KNRESAARSR ARKQAYTMEL EAEIAQLKEL NEELQKKQVE  420
IMEKQKNQLL EPLRQPWGMG CKRQCLRRTL TGPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.217690.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253263_at0.0
Expression AtlasAT4G34000-
AtGenExpressAT4G34000-
ATTED-IIAT4G34000-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and flowers. {ECO:0000269|PubMed:11884679}.
Functional Description ? help Back to Top
Source Description
TAIREncodes an ABA-responsive element-binding protein with similarity to transcription factors that is expressed in response to stress and abscisic acid.
UniProtBinds to the ABA-responsive element (ABRE). Mediates stress-responsive ABA signaling. {ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142}.
Function -- GeneRIF ? help Back to Top
  1. Makes transgenic plants more tolerant to stress conditions.
    [PMID: 15834008]
  2. The redundancy of function among genes in the families of ABF3 and ABI5 in A. thaliana is reported.
    [PMID: 16247556]
  3. AREB1, AREB2, and ABF3 are master transcription factors that regulate the ABRE-dependent expression of water-stress responsive genes in ABA signaling in response to water stresses in a cooperative manner.
    [PMID: 19947981]
  4. Overexpression of ABF3 has a minimal impact on the transcriptome, with differences in the gene expression pattern only detectable in response to drought.
    [PMID: 20105335]
  5. Data show that OST1 phosphorylates ABF3 on multiple LXRXXpS/T preferred motifs including T451 located in the midst of a conserved 14-3-3 binding site.
    [PMID: 21085673]
  6. ABF1 and ABF3 abundance is affected by ABA and KEG
    [PMID: 23742014]
  7. The abscisic acid feedback regulation of AtNCED3 expression is not mediated by ABF3.
    [PMID: 24475264]
  8. In this study, an attempt has been made to improve CT in drought hardy crop, peanut (Arachis hypogaea L., cv. TMV2) by co-expressing stress-responsive transcription factors (TFs), AtDREB2A, AtHB7 and AtABF3, associated with downstream gene expression
    [PMID: 25474740]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G34000.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA). {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:16284313}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G24650 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G11410(A), AT3G12580(A), AT5G52300(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G34000, AT1G10585, AT1G45249, AT1G49720
IntActSearch Q9M7Q3
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Defective in ABA and stress responses. {ECO:0000269|PubMed:15361142}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G34000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0935460.0AF093546.1 Arabidopsis thaliana clone 11 abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds.
GenBankAY0814670.0AY081467.1 Arabidopsis thaliana unknown protein (F17I5.190:F17I5.200) mRNA, complete cds.
GenBankAY0546050.0AY054605.1 Arabidopsis thaliana Unknown protein (F17I5.190:F17I5.200) mRNA, complete cds.
GenBankAK1758510.0AK175851.1 Arabidopsis thaliana mRNA for abscisic acid responsive elements-binding factor (ABRE/ABF3), complete cds, clone: RAFL22-47-B14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567949.10.0abscisic acid responsive elements-binding factor 3
RefseqNP_849490.20.0abscisic acid responsive elements-binding factor 3
SwissprotQ9M7Q30.0AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLD7MFS70.0D7MFS7_ARALL; Putative uncharacterized protein
STRINGAT4G34000.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Choi H,Hong J,Ha J,Kang J,Kim SY
    ABFs, a family of ABA-responsive element binding factors.
    J. Biol. Chem., 2000. 275(3): p. 1723-30
    [PMID:10636868]
  2. Finkelstein RR,Lynch TJ
    The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor.
    Plant Cell, 2000. 12(4): p. 599-609
    [PMID:10760247]
  3. Riechmann JL,Ratcliffe OJ
    A genomic perspective on plant transcription factors.
    Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34
    [PMID:11019812]
  4. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  5. Kang JY,Choi HI,Im MY,Kim SY
    Arabidopsis basic leucine zipper proteins that mediate stress-responsive abscisic acid signaling.
    Plant Cell, 2002. 14(2): p. 343-57
    [PMID:11884679]
  6. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  7. Kim SY,Ma J,Perret P,Li Z,Thomas TL
    Arabidopsis ABI5 subfamily members have distinct DNA-binding and transcriptional activities.
    Plant Physiol., 2002. 130(2): p. 688-97
    [PMID:12376636]
  8. Suzuki M,Ketterling MG,Li QB,McCarty DR
    Viviparous1 alters global gene expression patterns through regulation of abscisic acid signaling.
    Plant Physiol., 2003. 132(3): p. 1664-77
    [PMID:12857845]
  9. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  10. Kim S,Kang JY,Cho DI,Park JH,Kim SY
    ABF2, an ABRE-binding bZIP factor, is an essential component of glucose signaling and its overexpression affects multiple stress tolerance.
    Plant J., 2004. 40(1): p. 75-87
    [PMID:15361142]
  11. Oh SJ, et al.
    Arabidopsis CBF3/DREB1A and ABF3 in transgenic rice increased tolerance to abiotic stress without stunting growth.
    Plant Physiol., 2005. 138(1): p. 341-51
    [PMID:15834008]
  12. Finkelstein R,Gampala SS,Lynch TJ,Thomas TL,Rock CD
    Redundant and distinct functions of the ABA response loci ABA-INSENSITIVE(ABI)5 and ABRE-BINDING FACTOR (ABF)3.
    Plant Mol. Biol., 2005. 59(2): p. 253-67
    [PMID:16247556]
  13. Xin Z,Zhao Y,Zheng ZL
    Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1350-65
    [PMID:16258012]
  14. Fujita Y, et al.
    AREB1 Is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.
    Plant Cell, 2005. 17(12): p. 3470-88
    [PMID:16284313]
  15. Choi HI, et al.
    Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity.
    Plant Physiol., 2005. 139(4): p. 1750-61
    [PMID:16299177]
  16. Nakashima K, et al.
    Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.
    Plant Mol. Biol., 2006. 60(1): p. 51-68
    [PMID:16463099]
  17. Garcia ME,Lynch T,Peeters J,Snowden C,Finkelstein R
    A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings.
    Plant Mol. Biol., 2008. 67(6): p. 643-58
    [PMID:18484180]
  18. Li S,Xu C,Yang Y,Xia G
    Functional analysis of TaDi19A, a salt-responsive gene in wheat.
    Plant Cell Environ., 2010. 33(1): p. 117-29
    [PMID:19895399]
  19. Yoshida T, et al.
    AREB1, AREB2, and ABF3 are master transcription factors that cooperatively regulate ABRE-dependent ABA signaling involved in drought stress tolerance and require ABA for full activation.
    Plant J., 2010. 61(4): p. 672-85
    [PMID:19947981]
  20. Abdeen A,Schnell J,Miki B
    Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3.
    BMC Genomics, 2010. 11: p. 69
    [PMID:20105335]
  21. Lee SJ, et al.
    DREB2C interacts with ABF2, a bZIP protein regulating abscisic acid-responsive gene expression, and its overexpression affects abscisic acid sensitivity.
    Plant Physiol., 2010. 153(2): p. 716-27
    [PMID:20395451]
  22. Kline KG,Barrett-Wilt GA,Sussman MR
    In planta changes in protein phosphorylation induced by the plant hormone abscisic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(36): p. 15986-91
    [PMID:20733066]
  23. Li G, et al.
    Two cotton Cys2/His2-type zinc-finger proteins, GhDi19-1 and GhDi19-2, are involved in plant response to salt/drought stress and abscisic acid signaling.
    Plant Mol. Biol., 2010. 74(4-5): p. 437-52
    [PMID:20852918]
  24. Sirichandra C, et al.
    The Arabidopsis ABA-activated kinase OST1 phosphorylates the bZIP transcription factor ABF3 and creates a 14-3-3 binding site involved in its turnover.
    PLoS ONE, 2010. 5(11): p. e13935
    [PMID:21085673]
  25. Kim YY,Jung KW,Yoo KS,Jeung JU,Shin JS
    A stress-responsive caleosin-like protein, AtCLO4, acts as a negative regulator of ABA responses in Arabidopsis.
    Plant Cell Physiol., 2011. 52(5): p. 874-84
    [PMID:21471120]
  26. Kim JS, et al.
    An ABRE promoter sequence is involved in osmotic stress-responsive expression of the DREB2A gene, which encodes a transcription factor regulating drought-inducible genes in Arabidopsis.
    Plant Cell Physiol., 2011. 52(12): p. 2136-46
    [PMID:22025559]
  27. He Y, et al.
    Ectopic expression of a wheat MYB transcription factor gene, TaMYB73, improves salinity stress tolerance in Arabidopsis thaliana.
    J. Exp. Bot., 2012. 63(3): p. 1511-22
    [PMID:22140235]
  28. Qin Y, et al.
    Over-expression of TaMYB33 encoding a novel wheat MYB transcription factor increases salt and drought tolerance in Arabidopsis.
    Mol. Biol. Rep., 2012. 39(6): p. 7183-92
    [PMID:22350156]
  29. Lynch T,Erickson BJ,Finkelstein RR
    Direct interactions of ABA-insensitive(ABI)-clade protein phosphatase(PP)2Cs with calcium-dependent protein kinases and ABA response element-binding bZIPs may contribute to turning off ABA response.
    Plant Mol. Biol., 2012. 80(6): p. 647-58
    [PMID:23007729]
  30. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  31. Chen YT,Liu H,Stone S,Callis J
    ABA and the ubiquitin E3 ligase KEEP ON GOING affect proteolysis of the Arabidopsis thaliana transcription factors ABF1 and ABF3.
    Plant J., 2013. 75(6): p. 965-76
    [PMID:23742014]
  32. Yang YZ,Tan BC
    A distal ABA responsive element in AtNCED3 promoter is required for positive feedback regulation of ABA biosynthesis in Arabidopsis.
    PLoS ONE, 2014. 9(1): p. e87283
    [PMID:24475264]
  33. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  34. Pruthvi V,Narasimhan R,Nataraja KN
    Simultaneous expression of abiotic stress responsive transcription factors, AtDREB2A, AtHB7 and AtABF3 improves salinity and drought tolerance in peanut (Arachis hypogaea L.).
    PLoS ONE, 2014. 9(12): p. e111152
    [PMID:25474740]
  35. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]