PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G32890.1
Common NameF26P21.10, GATA9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 308aa    MW: 34346.2 Da    PI: 4.9266
Description GATA transcription factor 9
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G32890.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.51.6e-17199233135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  AT4G32890.1 199 CLHCATEKTPQWRTGPMGPKTLCNACGVRYKSGRL 233
                  99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-1131289IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.255193229IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-17193243IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-15195257No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14195231IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.07E-14198245No hitNo description
PROSITE patternPS003440199224IPR000679Zinc finger, GATA-type
PfamPF003202.6E-15199233IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEKIAPELFL VAGNPDSFVV DDLLDFSNDD GEVDDGLNTL PDSSTLSTGT LTDSSNSSSL  60
FTDGTGFSDL YIPNDDIAEL EWLSNFVEES FAGEDQDKLH LFSGLKNPQT TGSTLTHLIK  120
PEPELDHQFI DIDESNVAVP AKARSKRSRS AASTWASRLL SLADSDETNP KKKQRRVKEQ  180
DFAGDMDVDC GESGGGRRCL HCATEKTPQW RTGPMGPKTL CNACGVRYKS GRLVPEYRPA  240
SSPTFVMARH SNSHRKVMEL RRQKEMRDEH LLSQLRCENL LMDIRSNGED FLMHNNTNHV  300
APDFRHLI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169175PKKKQRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.24680.0bud
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306895330.0
Genevisible253406_at0.0
Expression AtlasAT4G32890-
AtGenExpressAT4G32890-
ATTED-IIAT4G32890-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G32890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G32890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0083420.0BT008342.1 Arabidopsis thaliana At4g32890 mRNA, complete cds.
GenBankAK1171690.0AK117169.1 Arabidopsis thaliana At4g32890 mRNA for unknown protein, complete cds, clone: RAFL16-71-E16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195015.10.0GATA transcription factor 9
SwissprotO826320.0GATA9_ARATH; GATA transcription factor 9
TrEMBLD7M9N00.0D7M9N0_ARALL; Zinc finger family protein
STRINGAT4G32890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56822749
Representative plantOGRP6817287
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  4. Hammond JP, et al.
    Changes in gene expression in Arabidopsis shoots during phosphate starvation and the potential for developing smart plants.
    Plant Physiol., 2003. 132(2): p. 578-96
    [PMID:12805589]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  7. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  8. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  9. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]