PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G32040.1
Common NameF10N7.150, KNAT5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 383aa    MW: 43283.6 Da    PI: 6.4579
Description KNOTTED1-like homeobox gene 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G32040.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78.3e-083273602154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp++e++++L +++gL+ +q+ +WF N+R +
  AT4G32040.1 327 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 360
                  569*****************************87 PP

2ELK26.81.2e-09281302122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELKh+L+++++++++++++E++
  AT4G32040.1 281 ELKHELKQGFKEKIVDIREEIM 302
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.1E-19116160IPR005540KNOX1
PfamPF037903.8E-17118159IPR005540KNOX1
SMARTSM012563.0E-26167222IPR005541KNOX2
PfamPF037911.4E-19171221IPR005541KNOX2
PROSITE profilePS512139.446281301IPR005539ELK domain
PfamPF037892.9E-6281302IPR005539ELK domain
SMARTSM011886.2E-4281302IPR005539ELK domain
PROSITE profilePS5007111.985301364IPR001356Homeobox domain
SMARTSM003894.0E-10303368IPR001356Homeobox domain
SuperFamilySSF466891.92E-15303367IPR009057Homeodomain-like
CDDcd000865.88E-11304360No hitNo description
Gene3DG3DSA:1.10.10.608.8E-25308366IPR009057Homeodomain-like
PfamPF059201.7E-17321360IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009727Biological Processdetection of ethylene stimulus
GO:0071369Biological Processcellular response to ethylene stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003000anatomytransition zone
PO:0006036anatomyroot epidermis
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025181anatomyroot elongation zone
PO:0025281anatomypollen
PO:0001031developmental stage4 root elongation stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MSFNSSHLLP PQEDLPLRHF TDQSQQPPPQ RHFSETPSLV TASFLNLPTT LTTADSDLAP  60
PHRNGDNSVA DTNPRWLSFH SEMQNTGEVR SEVIDGVNAD GETILGVVGG EDWRSASYKA  120
AILRHPMYEQ LLAAHVACLR VATPVDQIPR IDAQLSQLHT VAAKYSTLGV VVDNKELDHF  180
MSHYVVLLCS FKEQLQHHVC VHAMEAITAC WEIEQSLQSL TGVSPSESNG KTMSDDEDDN  240
QVESEVNMFD GSLDGSDCLM GFGPLVPTER ERSLMERVKK ELKHELKQGF KEKIVDIREE  300
IMRKRRAGKL PGDTTSVLKE WWRTHSKWPY PTEEDKAKLV QETGLQLKQI NNWFINQRKR  360
NWNSNSSTSS TLTKNKRKRT GKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1357378RKRNWNSNSSTSSTLTKNKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.207040.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425673210.0
Genevisible253466_at0.0
Expression AtlasAT4G32040-
AtGenExpressAT4G32040-
ATTED-IIAT4G32040-
Functional Description ? help Back to Top
Source Description
TAIRA member of Class II KN1-like homeodomain transcription factors factors (together with KNAT3 and KNAT4), with greatest homology to the maize knox1 homeobox protein. Regulates photomorphogenic responses and represses late steps in gibberellin biosynthesis. KNAT5 promoter activity showed cell-type specific pattern along longitudinal root axis, primarily in the epidermis of the distal end of primary root elongation zone.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G32040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDethylene
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G32040, AT4G34610, AT4G36870, AT5G02030, AT5G41410, AT1G19700, AT1G23380, AT1G26260, AT1G62990, AT1G75410
IntActSearch P48002
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G32040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD439620.0D43962.1 Arabidopsis thaliana mRNA for homeodomein containing protein 1, complete cds.
GenBankBT0260330.0BT026033.1 Arabidopsis thaliana At4g32040 mRNA, complete cds.
GenBankAF3066610.0AF306661.1 Arabidopsis thaliana homeodomain transcription factor KNAT5 (KNAT5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194932.10.0homeobox protein knotted-1-like 5
SwissprotP480020.0KNAT5_ARATH; Homeobox protein knotted-1-like 5
TrEMBLD7MAS60.0D7MAS6_ARALL; Putative uncharacterized protein
STRINGAT4G32040.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MalvidsOGEM44428158
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bellaoui M, et al.
    The Arabidopsis BELL1 and KNOX TALE homeodomain proteins interact through a domain conserved between plants and animals.
    Plant Cell, 2001. 13(11): p. 2455-70
    [PMID:11701881]
  3. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  4. Truernit E,Siemering KR,Hodge S,Grbic V,Haseloff J
    A map of KNAT gene expression in the Arabidopsis root.
    Plant Mol. Biol., 2006. 60(1): p. 1-20
    [PMID:16463096]
  5. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  6. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  7. Truernit E,Haseloff J
    A Role for KNAT Class II Genes in Root Development.
    Plant Signal Behav, 2007. 2(1): p. 10-2
    [PMID:19704797]
  8. Serikawa KA,Martinez-Laborda A,Zambryski P
    Three knotted1-like homeobox genes in Arabidopsis.
    Plant Mol. Biol., 1996. 32(4): p. 673-83
    [PMID:8980519]