PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31920.1
Common NameARP4, ARR10, F10N7.270, RR10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 552aa    MW: 61652.2 Da    PI: 6.2321
Description response regulator 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31920.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.42.5e-26183236155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+ Wt+eLH++F+ av++L G e+A+Pk+il+lm+v+ Lt+e+v+SHLQk+R+
  AT4G31920.1 183 KPRVLWTHELHNKFLAAVDHL-GVERAVPKKILDLMNVDKLTRENVASHLQKFRV 236
                  79*******************.********************************7 PP

2Response_reg882.7e-29191271109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+++ +++l+++l++ +y +v+++ +++ alell+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++++++ + +k Ga 
   AT4G31920.1  19 VLAVDDDQTCLRILQTLLQRCQY-HVTTTNQAQTALELLRENKnkFDLVISDVDMPDMDGFKLLELVGL-EMDLPVIMLSAHSDPKYVMKGVKHGAC 113
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
   AT4G31920.1 114 DYLLKPVRIEELKN 127
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.4E-1671541IPR017053Response regulator B-type, plant
SuperFamilySSF521729.11E-3716141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.4E-4416166No hitNo description
SMARTSM004481.1E-3417129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.90518133IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.7E-2619127IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.44E-3020132No hitNo description
PROSITE profilePS5129413.742180239IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-27180240IPR009057Homeodomain-like
SuperFamilySSF466895.91E-19181240IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24183236IPR006447Myb domain, plants
PfamPF002491.4E-5187234IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000025anatomyroot tip
PO:0000036anatomyleaf vascular system
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005660anatomyhydathode
PO:0006079anatomyshoot system meristem
PO:0006339anatomyjuvenile vascular leaf
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MTMEQEIEVL DQFPVGMRVL AVDDDQTCLR ILQTLLQRCQ YHVTTTNQAQ TALELLRENK  60
NKFDLVISDV DMPDMDGFKL LELVGLEMDL PVIMLSAHSD PKYVMKGVKH GACDYLLKPV  120
RIEELKNIWQ HVVRKSKLKK NKSNVSNGSG NCDKANRKRK EQYEEEEEEE RGNDNDDPTA  180
QKKPRVLWTH ELHNKFLAAV DHLGVERAVP KKILDLMNVD KLTRENVASH LQKFRVALKK  240
VSDDAIQQAN RAAIDSHFMQ MNSQKGLGGF YHHHRGIPVG SGQFHGGTTM MRHYSSNRNL  300
GRLNSLGAGM FQPVSSSFPR NHNDGGNILQ GLPLEELQIN NNINRAFPSF TSQQNSPMVA  360
PSNLLLLEGN PQSSSLPSNP GFSPHFEISK RLEHWSNAAL STNIPQSDVH SKPDTLEWNA  420
FCDSASPLVN PNLDTNPASL CRNTGFGSTN AAQTDFFYPL QMNQQPANNS GPVTEAQLFR  480
SSNPNEGLLM GQQKLQSGLM ASDAGSLDDI VNSLMTQEQS QSDFSEGDWD LDGLAHSEHA  540
YEKLHFPFSL SA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-36179242164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.1220.0flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453509870.0
Genevisible253500_at0.0
Expression AtlasAT4G31920-
AtGenExpressAT4G31920-
ATTED-IIAT4G31920-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in roots and leaves. {ECO:0000269|PubMed:15173562}.
Functional Description ? help Back to Top
Source Description
TAIREncodes an Arabidopsis response regulator (ARR) protein that acts in concert with other type-B ARRs in the cytokinin signaling pathway.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. {ECO:0000269|PubMed:11574878}.
Function -- GeneRIF ? help Back to Top
  1. ARR10 and ARR12play pivotal roles in the histidine kinase-dependent phosphorelay signaling in response to cytokinin in roots.
    [PMID: 17132632]
  2. The results of this study suggested that ARR1, ARR10 and ARR12 together play essential (or general) roles in cytokinin signal transduction.
    [PMID: 18037673]
  3. Results support a model in which cytokinin regulates a wide array of downstream responses through the action of a multistep phosphorelay that culminates in transcriptional regulation by ARR1, ARR10, and ARR12.
    [PMID: 18723577]
  4. An arr1,10,12 triple mutant had more drought tolerance due to enhanced cell membrane integrity, anthocyanin synthesis, and abscissic acid hypersensitivity, and reduced stomatal aperture. Dehydration and ABA repressed all 3 genes.
    [PMID: 26884175]
  5. The role of ARR10 in regulating the cytokinin response and growth in Arabidopsis
    [PMID: 28673986]
  6. The expression signals of AG were detected in the initiating carpel primordia and regenerating carpels, and co-localized with those of two Type-B ARABIDOPSIS RESPONSE REGULATORs (ARRs), ARR1 and ARR10.
    [PMID: 29186581]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00072SELEX26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G62920(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDcytokinin
Interaction ? help Back to Top
Source Intact With
IntActSearch O49397
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0051950.0AJ005195.1 Arabidopsis thaliana mRNA for receiver-like protein 4.
GenBankAK2281490.0AK228149.1 Arabidopsis thaliana mRNA for predicted protein, complete cds, clone: RAFL14-61-J20.
GenBankBT0031580.0BT003158.1 Arabidopsis thaliana At4g31920 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194920.10.0response regulator 10
SwissprotO493970.0ARR10_ARATH; Two-component response regulator ARR10
TrEMBLA0A384KXN70.0A0A384KXN7_ARATH; Two-component response regulator
TrEMBLQ0WRZ40.0Q0WRZ4_ARATH; Two-component response regulator
STRINGAT4G31920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Representative plantOGRP29217120
Publications ? help Back to Top
  1. Imamura A, et al.
    Compilation and characterization of Arabidopsis thaliana response regulators implicated in His-Asp phosphorelay signal transduction.
    Plant Cell Physiol., 1999. 40(7): p. 733-42
    [PMID:10501033]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Suzuki T,Sakurai K,Ueguchi C,Mizuno T
    Two types of putative nuclear factors that physically interact with histidine-containing phosphotransfer (Hpt) domains, signaling mediators in His-to-Asp phosphorelay, in Arabidopsis thaliana.
    Plant Cell Physiol., 2001. 42(1): p. 37-45
    [PMID:11158442]
  4. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  5. Haberer G,Kieber JJ
    Cytokinins. New insights into a classic phytohormone.
    Plant Physiol., 2002. 128(2): p. 354-62
    [PMID:11842139]
  6. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  7. Hosoda K, et al.
    Molecular structure of the GARP family of plant Myb-related DNA binding motifs of the Arabidopsis response regulators.
    Plant Cell, 2002. 14(9): p. 2015-29
    [PMID:12215502]
  8. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  9. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  10. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  11. Mason MG, et al.
    Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis.
    Plant Cell, 2005. 17(11): p. 3007-18
    [PMID:16227453]
  12. Dortay H,Mehnert N,B
    Analysis of protein interactions within the cytokinin-signaling pathway of Arabidopsis thaliana.
    FEBS J., 2006. 273(20): p. 4631-44
    [PMID:16965536]
  13. Yokoyama A, et al.
    Type-B ARR transcription factors, ARR10 and ARR12, are implicated in cytokinin-mediated regulation of protoxylem differentiation in roots of Arabidopsis thaliana.
    Plant Cell Physiol., 2007. 48(1): p. 84-96
    [PMID:17132632]
  14. Ishida K,Yamashino T,Yokoyama A,Mizuno T
    Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(1): p. 47-57
    [PMID:18037673]
  15. Dortay H, et al.
    Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana.
    J. Proteome Res., 2008. 7(9): p. 3649-60
    [PMID:18642946]
  16. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  17. Argyros RD, et al.
    Type B response regulators of Arabidopsis play key roles in cytokinin signaling and plant development.
    Plant Cell, 2008. 20(8): p. 2102-16
    [PMID:18723577]
  18. Perochon A, et al.
    Interaction of a plant pseudo-response regulator with a calmodulin-like protein.
    Biochem. Biophys. Res. Commun., 2010. 398(4): p. 747-51
    [PMID:20627089]
  19. Kondo Y,Hirakawa Y,Kieber JJ,Fukuda H
    CLE peptides can negatively regulate protoxylem vessel formation via cytokinin signaling.
    Plant Cell Physiol., 2011. 52(1): p. 37-48
    [PMID:20802224]
  20. Nemoto K, et al.
    Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system.
    Phytochemistry, 2011. 72(10): p. 1136-44
    [PMID:21477822]
  21. Kushwah S,Jones AM,Laxmi A
    Cytokinin interplay with ethylene, auxin, and glucose signaling controls Arabidopsis seedling root directional growth.
    Plant Physiol., 2011. 156(4): p. 1851-66
    [PMID:21666052]
  22. Cutcliffe JW,Hellmann E,Heyl A,Rashotte AM
    CRFs form protein-protein interactions with each other and with members of the cytokinin signalling pathway in Arabidopsis via the CRF domain.
    J. Exp. Bot., 2011. 62(14): p. 4995-5002
    [PMID:21705390]
  23. Das PK, et al.
    Cytokinins enhance sugar-induced anthocyanin biosynthesis in Arabidopsis.
    Mol. Cells, 2012. 34(1): p. 93-101
    [PMID:22699753]
  24. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  25. Hill K, et al.
    Functional characterization of type-B response regulators in the Arabidopsis cytokinin response.
    Plant Physiol., 2013. 162(1): p. 212-24
    [PMID:23482873]
  26. Hill K,Schaller GE
    Enhancing plant regeneration in tissue culture: a molecular approach through manipulation of cytokinin sensitivity.
    Plant Signal Behav, 2013. 8(10): p. doi: 10.4161/psb.25709
    [PMID:23887495]
  27. Ramireddy E,Chang L,Schm├╝lling T
    Cytokinin as a mediator for regulating root system architecture in response to environmental cues.
    Plant Signal Behav, 2014. 9(1): p. e27771
    [PMID:24509549]
  28. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  29. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  30. Nguyen KH, et al.
    Arabidopsis type B cytokinin response regulators ARR1, ARR10, and ARR12 negatively regulate plant responses to drought.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(11): p. 3090-5
    [PMID:26884175]
  31. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  32. Street IH, et al.
    Cytokinin acts through the auxin influx carrier AUX1 to regulate cell elongation in the root.
    Development, 2016. 143(21): p. 3982-3993
    [PMID:27697901]
  33. Wang Y,Wu Y,Yu B,Yin Z,Xia Y
    EXTRA-LARGE G PROTEINs Interact with E3 Ligases PUB4 and PUB2 and Function in Cytokinin and Developmental Processes.
    Plant Physiol., 2017. 173(2): p. 1235-1246
    [PMID:27986866]
  34. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  35. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  36. Zubo YO, et al.
    Cytokinin induces genome-wide binding of the type-B response regulator ARR10 to regulate growth and development in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(29): p. E5995-E6004
    [PMID:28673986]
  37. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  38. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  39. Bustillo-Avenda├▒o E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]