PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31690.1
Common NameF28M20.120, REM9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 461aa    MW: 51456.9 Da    PI: 6.3357
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31690.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B364.81.3e-2022991196
                 HHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3 11 lksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                 ++s+ l +p ++++eh +g k+e+kt+tl++  s r+Wevk+  ++++    lt+GWkeFv+a++L+ gDfvvF+++g++ f  +v++
  AT4G31690.1 22 FQSN-LKIPVNYFSEHiEG-KHEGKTVTLRTdASERTWEVKM--EGHR----LTEGWKEFVEAHDLRIGDFVVFRHEGDMVF--HVTA 99
                 5555.9**********644.467789999986899*******..6666....************************999999..7665 PP

2B370.52.2e-22149243299
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  f++ +++++ +++ +++p++f+++ g +k ++ +++l++e+g+sWe +++ +  sg+++l +GW  F+ +n+L++gD+++Fkl + + +++v++++++
  AT4G31690.1 149 FSQSVTHSNISRDAVSVPRDFVKRSGFSKGRH-EIVLMNEEGKSWESEVK-SYMSGAVYLVGGWTTFCTENKLDVGDSCTFKLLQ-KAKTPVFQLCSR 243
                  5788899999**************98887665.****************3.5555669************************998.88889****997 PP

3B330.66e-102463141786
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-.TTHHHHHHHHT--TT-EEEEEE-S CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvlt.kGWkeFvkangLkegDfvvFkldg 86 
                   lp +f++ +g+++++  +++l d++  +W++ l+++ ++  y+++ + Wk+F+ an++ +g+++ ++l++
  AT4G31690.1 246 HLPLSFTKVNGLINPG--KIILVDKDRAEWSMMLKVDSRGAVYIIGgNDWKSFCAANEVGAGESLALELIQ 314
                  69*****999999665..8***************666665557666367******************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-266105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-249110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.9311103IPR003340B3 DNA binding domain
CDDcd100171.04E-201398No hitNo description
SMARTSM010192.6E-2614103IPR003340B3 DNA binding domain
PfamPF023628.2E-152495IPR003340B3 DNA binding domain
SuperFamilySSF1019368.83E-21142241IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-22142242IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.734148244IPR003340B3 DNA binding domain
CDDcd100173.95E-18148242No hitNo description
SMARTSM010192.2E-26149244IPR003340B3 DNA binding domain
PfamPF023621.5E-21149243IPR003340B3 DNA binding domain
SMARTSM010191.2E-4245328IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.4E-10246318IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-12246321IPR015300DNA-binding pseudobarrel domain
PfamPF023626.7E-9246315IPR003340B3 DNA binding domain
CDDcd100176.15E-12247316No hitNo description
PROSITE profilePS5086310.546247332IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MANASPLSPT NQHFFQPLLP GFQSNLKIPV NYFSEHIEGK HEGKTVTLRT DASERTWEVK  60
MEGHRLTEGW KEFVEAHDLR IGDFVVFRHE GDMVFHVTAL GPSCCEIQYP QSSRHEEGEE  120
SGENEISEKE GEENVQKESD KSSSDLNCFS QSVTHSNISR DAVSVPRDFV KRSGFSKGRH  180
EIVLMNEEGK SWESEVKSYM SGAVYLVGGW TTFCTENKLD VGDSCTFKLL QKAKTPVFQL  240
CSRTKHLPLS FTKVNGLINP GKIILVDKDR AEWSMMLKVD SRGAVYIIGG NDWKSFCAAN  300
EVGAGESLAL ELIQGGVLLN QITTCFQMEQ PSFKAEDGRH KRARVQNRSQ ETDKGAETSR  360
ASTMGPKLEI TEKGEPSRAS TMRPKVEIRE KIAETGEPSR ASNKSSGIEG NLQHTKPCSV  420
KTDQLAKVKE SVVDTLTSIG RFQAELETMK RKLEDSLQEL N
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G31690
AtGenExpressAT4G31690
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412940.0AJ441294.1 Arabidopsis thaliana mRNA for putative auxin response factor 23 (arf23 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194896.20.0Transcriptional factor B3 family protein
SwissprotO817780.0REM9_ARATH; B3 domain-containing protein REM9
TrEMBLA0A178V3E40.0A0A178V3E4_ARATH; Uncharacterized protein
STRINGAT4G31690.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Froehlich JE, et al.
    Proteomic study of the Arabidopsis thaliana chloroplastic envelope membrane utilizing alternatives to traditional two-dimensional electrophoresis.
    J. Proteome Res., 2003 Jul-Aug. 2(4): p. 413-25
    [PMID:12938931]
  2. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  3. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]
  4. Wang S, et al.
    Chloroplast RNA-Binding Protein RBD1 Promotes Chilling Tolerance through 23S rRNA Processing in Arabidopsis.
    PLoS Genet., 2016. 12(5): p. e1006027
    [PMID:27138552]