PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31680.1
Common NameARF24, F28M20.130, REM8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 462aa    MW: 52024.6 Da    PI: 6.6798
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31680.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B364.31.8e-201499196
                 EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                 ffk l     ++++ l +p kf++eh +gk +e+ t++l+   s r+Wevk+  ++++    lt+GWkeFv+a++L+ +DfvvF+++g++ f  +v++
  AT4G31680.1 14 FFKPL--LPGFQRN-LNIPVKFFSEHiEGK-HEGETVKLRAdASKRTWEVKM--DGNR----LTEGWKEFVEAHDLRIRDFVVFRHEGDMVF--HVTA 99
                 66667..6667776.***********7544.56679999976899*******..9999....************************999999..7665 PP

2B374.81e-23149243299
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  f++ +++++ ++++++lp++fa+++g++k  + +++l++e+g+sWe +++ ++ sg++++ +GWk+ +++n+Lk gD+++Fkl + + +++v++++++
  AT4G31680.1 149 FSQSVTHSNISNDLVTLPRDFAKRNGLDKGMH-EIVLMNEEGKSWESEVR-SRMSGQVFIVGGWKSLCSENKLKGGDSCTFKLLQ-NAKTPVFQLCSR 243
                  6788999*******************998765.****************5.66667799999********************998.67779***9987 PP

3B347.82.5e-15249345199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-.TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvlt.kGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  f+k + + ++l+ g   lp +f++ +g+++++  +++l d++  +W++kl++++++g+++++ + Wk+F+ an++ +g++++++l++  + ++++k+f
  AT4G31680.1 249 FVKLTPTLNSLEIGKQHLPVSFTKGNGLIHPG--EIILVDKDRVEWSMKLQVDNRGGMHIFGgNDWKSFCAANEVGAGESLTLELIR-GGLSPLFKFF 343
                  66777778888889999************776..8*****************9999997777377********************98.89999**999 PP

                  -S CS
           B3  98 rk 99 
                  +k
  AT4G31680.1 344 SK 345
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-275105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-239110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.73111103IPR003340B3 DNA binding domain
CDDcd100172.08E-191298No hitNo description
SMARTSM010197.3E-2514103IPR003340B3 DNA binding domain
PfamPF023624.4E-142395IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.3E-22142242IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-21143241IPR015300DNA-binding pseudobarrel domain
CDDcd100171.84E-18148242No hitNo description
PROSITE profilePS5086314.635148243IPR003340B3 DNA binding domain
PfamPF023626.4E-23149243IPR003340B3 DNA binding domain
SMARTSM010191.3E-30149244IPR003340B3 DNA binding domain
CDDcd100172.71E-16248344No hitNo description
PfamPF023621.8E-14249345IPR003340B3 DNA binding domain
PROSITE profilePS5086312.647249346IPR003340B3 DNA binding domain
SMARTSM010196.8E-23249346IPR003340B3 DNA binding domain
SuperFamilySSF1019364.9E-15249347IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-12250342IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MANASQLSPT NKHFFKPLLP GFQRNLNIPV KFFSEHIEGK HEGETVKLRA DASKRTWEVK  60
MDGNRLTEGW KEFVEAHDLR IRDFVVFRHE GDMVFHVTAL GPSCCEIQYP QSISHEEGEE  120
SGEVEISERE VEENLQKEYD QSSADLNCFS QSVTHSNISN DLVTLPRDFA KRNGLDKGMH  180
EIVLMNEEGK SWESEVRSRM SGQVFIVGGW KSLCSENKLK GGDSCTFKLL QNAKTPVFQL  240
CSRIGESRFV KLTPTLNSLE IGKQHLPVSF TKGNGLIHPG EIILVDKDRV EWSMKLQVDN  300
RGGMHIFGGN DWKSFCAANE VGAGESLTLE LIRGGLSPLF KFFSKIEQPS FEAEDRRHKR  360
ARVHNGSQET DKGEPSRATK MGPELEKREK TAEKGEPSRA SNKSSGKQGN LQKTQACSVT  420
DHVAKVKESV VDTLTSIRRF QAELETMEQK LEDSLQEINK LS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453508360.0
Genevisible253508_at0.0
Expression AtlasAT4G31680-
AtGenExpressAT4G31680-
ATTED-IIAT4G31680-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5152620.0AJ515262.1 Arabidopsis thaliana mRNA for putative auxin response factor 24 (arf24 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194896.20.0transcriptional factor B3 family protein
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLR0GZI50.0R0GZI5_9BRAS; Uncharacterized protein
STRINGAT4G31680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2682231
MalvidsOGEM20422261
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]