PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31630.1
Common NameF28M20.180, REM4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 512aa    MW: 57354.1 Da    PI: 6.3674
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31630.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.67.9e-12231001397
                  TT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3  13 sgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  +++ ++p +f+ +h + k +s+ ++l++  s r W+vkl  ++ +    +++GWk+F  ++ +++ D + F++dg + f  +v+ f
  AT4G31630.1  23 KSNPIIPTEFIWNHFNGKIQSTNMKLTSdASDRNWDVKL--DGAR----FAGGWKDFSVSHSVRDDDLLSFRHDGGMVF--HVSPF 100
                  34479*********555567888888886999*******..8888....9**********************9998888..77766 PP

2B365.39.5e-21174264698
                  ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  +++++l ++++++  kfa+++g++ +e  ++ l+de+ +sW++ l+++kk g+ ++++GW++F++ ng+k+g ++ Fkl++ s+ ++v++++ 
  AT4G31630.1 174 VTPSSLLRDNMCVLSKFARSNGLDRRE-CEIDLRDEHEKSWTLLLRHNKKTGQAFMRGGWRSFCRNNGIKAGSICRFKLVQ-SGIKPVLQLCP 264
                  455566666699999******999655.6**************************************************98.89999999886 PP

3B347.24.1e-15312402699
                  ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--.TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk.egDfvvFkldgrsefelvvkvfrk 99 
                  ++++v++s+++ lp +fa+e+g+++++  ++t+ +++g +W+  l   k++++ +  +G ++F  ang+k +gD +++++++  + ++ +k+++k
  AT4G31630.1 312 LKPYVFRSCQFFLPASFARENGIVEAG--EVTVLNKDGIEWKSHLVNIKGRDQ-FYNRGCQDFFVANGVKnVGDPFTLEVIR-GGPSPILKICSK 402
                  579*********************877..7***************65555555.5688************9********997.677789999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.87E-148103IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.78511103IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.2E-1312103IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.2E-1614103IPR003340B3 DNA binding domain
CDDcd100175.41E-1227100No hitNo description
Gene3DG3DSA:2.40.330.108.1E-22162265IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-20163265IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.1E-26169266IPR003340B3 DNA binding domain
CDDcd100171.85E-20169264No hitNo description
PROSITE profilePS5086312.605169265IPR003340B3 DNA binding domain
PfamPF023629.1E-20173264IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.8E-8304401IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-10305401IPR015300DNA-binding pseudobarrel domain
CDDcd100179.16E-9306401No hitNo description
SMARTSM010191.9E-16307403IPR003340B3 DNA binding domain
PROSITE profilePS508637.881307403IPR003340B3 DNA binding domain
PfamPF023622.0E-14311402IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020094anatomyplant egg cell
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MADPLIPSPT NKAFFIIDLS GQKSNPIIPT EFIWNHFNGK IQSTNMKLTS DASDRNWDVK  60
LDGARFAGGW KDFSVSHSVR DDDLLSFRHD GGMVFHVSPF GRSFSQIQLI SSSTSDDDDD  120
ERTVFDDDED DDVGDDDDNS ISEDDFCSKK ISSKKRARKE TESSSDKSYL VAHVTPSSLL  180
RDNMCVLSKF ARSNGLDRRE CEIDLRDEHE KSWTLLLRHN KKTGQAFMRG GWRSFCRNNG  240
IKAGSICRFK LVQSGIKPVL QLCPNASSIP EGNSSKARKK RNVSEIEGDE IESENCSETI  300
PLNQNKILTF DLKPYVFRSC QFFLPASFAR ENGIVEAGEV TVLNKDGIEW KSHLVNIKGR  360
DQFYNRGCQD FFVANGVKNV GDPFTLEVIR GGPSPILKIC SKVKQAASSD GHKTADRKPR  420
MTDQAPLAEE QTDNRVEKRA QVTEEGGPSR STRADPGNLQ QKQPCSISDH VKKVKQSIVD  480
TLTDVRRFQS ELKVKEQNLE ASLQEIDALG MI
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184178430.0
Genevisible253541_at0.0
Expression AtlasAT4G31630-
AtGenExpressAT4G31630-
ATTED-IIAT4G31630-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0310040.0AL031004.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F28M20 (ESSAII project).
GenBankAL1615790.0AL161579.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 75.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194891.10.0Transcriptional factor B3 family protein
SwissprotQ9SB790.0REM4_ARATH; Putative B3 domain-containing protein REM4
TrEMBLA0A178V3B80.0A0A178V3B8_ARATH; Uncharacterized protein
STRINGAT4G31630.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96581537
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  2. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  3. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]