PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31615.1
Common NameF28M20.2, REM2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 487aa    MW: 55036.1 Da    PI: 8.845
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31615.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.91.8e-13251001596
                  -EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3  15 rlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                    ++p +f++++ +gk+++s++l+l++    r+Wevkl  ++++    +++GW++F   + L++ D+v+F+ +g+++f  +v++
  AT4G31615.1  25 SPMIPAEFFSTYvEGKNHQSTKLKLTSdAFDRTWEVKL--NGRR----FAGGWENFSTVHSLQDDDVVIFREIGDMTF--HVTA 100
                  479**********8888999*****996778*******..8887....99*********************8898888..6665 PP

2B363.24.1e-20155245597
                  -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                   +++++l+++rl+l k fa+++g+++++  ++ l++++g+sW++ l+y+   ++  +++GW++F+  ngL++g f  Fkl+++ +++++++++
  AT4G31615.1 155 HVTPSNLSRDRLYLIKAFARSNGLNERCC-EIDLMNKHGKSWTLGLRYSTVNDQASISGGWRDFCLVNGLEAGSFYRFKLVQN-GERPLLRLC 245
                  67999********************8775.******************88888889************************995.555777665 PP

3B373.62.4e-232743721100
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  f++ + ++++lksg+l+l+++fa e+++k++e  ++tl d++g  W  ++   ++++g+y+l+kGW++F+ an+Lk+g+++++++++ +++++++k++
  AT4G31615.1 274 FLTMTFKPYMLKSGQLRLSRPFAIENEIKEAE--DITLVDKNGGNWPSYVASgDGQGGKYYLAKGWRSFCAANRLKTGETFTLEFVRGEGTTPMLKFC 369
                  66777899******************999777..7***************767999999***************************99********** PP

                  -SS CS
           B3  98 rks 100
                  +ks
  AT4G31615.1 370 SKS 372
                  985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.9E-157104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-167106IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.84211104IPR003340B3 DNA binding domain
CDDcd100171.66E-111299No hitNo description
SMARTSM010195.3E-1814104IPR003340B3 DNA binding domain
PfamPF023621.2E-72698IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-20144245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-20146248IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.1E-27151248IPR003340B3 DNA binding domain
PROSITE profilePS5086313.69151247IPR003340B3 DNA binding domain
CDDcd100172.45E-20151245No hitNo description
PfamPF023621.3E-18154245IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-17268371IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-18274373IPR015300DNA-binding pseudobarrel domain
PfamPF023629.3E-22274371IPR003340B3 DNA binding domain
SMARTSM010192.1E-29274372IPR003340B3 DNA binding domain
PROSITE profilePS5086314.494274371IPR003340B3 DNA binding domain
CDDcd100179.84E-16274362No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MDDPAISSPT NKHFFVIVLH GHKSSPMIPA EFFSTYVEGK NHQSTKLKLT SDAFDRTWEV  60
KLNGRRFAGG WENFSTVHSL QDDDVVIFRE IGDMTFHVTA SGRSFCKLQY ISSDEDRADE  120
DDAWNVYSDS KNIVSKKKPR TEAESSSKNY YLVAHVTPSN LSRDRLYLIK AFARSNGLNE  180
RCCEIDLMNK HGKSWTLGLR YSTVNDQASI SGGWRDFCLV NGLEAGSFYR FKLVQNGERP  240
LLRLCYDTIP EEDCYKGNRK VNLSESASMK QGKFLTMTFK PYMLKSGQLR LSRPFAIENE  300
IKEAEDITLV DKNGGNWPSY VASGDGQGGK YYLAKGWRSF CAANRLKTGE TFTLEFVRGE  360
GTTPMLKFCS KSKDKIEQVP FDEGGETQEE TETRVKKRAR VSAERGSSRR NQASNKPNAD  420
PQNLQPGQPH CSISDQVQKV KQIIVDTLTG IKRIRSELER KGQKLEASIL EIDALGEKVS  480
EINKILK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.317320.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865152730.0
Genevisible253540_at1e-126
Expression AtlasAT4G31615-
AtGenExpressAT4G31615-
ATTED-IIAT4G31615-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31615.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31615
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937130.0AB493713.1 Arabidopsis thaliana At4g31615 mRNA for hypothetical protein, partial cds, clone: RAAt4g31615.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_680753.20.0Transcriptional factor B3 family protein
SwissprotQ3E9T20.0REM2_ARATH; B3 domain-containing protein REM2
TrEMBLA0A178UZV30.0A0A178UZV3_ARATH; Uncharacterized protein
STRINGAT4G31615.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96581537
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  2. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]