PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G30935.1
Common NameATWRKY32, F6I18.4, WRKY32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 466aa    MW: 51480.4 Da    PI: 5.8948
Description WRKY DNA-binding protein 32
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G30935.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.86.9e-26168224259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++vvei+++g H+he
  AT4G30935.1 168 RDGYNWRKYGQKQVKSPKGSRSYYRCTYTECCAKK-IECSNDSGNVVEIVNKGLHTHE 224
                  7********************************98.*********************8 PP

2WRKY98.54.4e-31331388259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++k+v+itY+g Hnh+
  AT4G30935.1 331 GDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVENTKAVIITYKGVHNHD 388
                  5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182903.01E-20163226IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-20163226IPR003657WRKY domain
SMARTSM007745.4E-25167225IPR003657WRKY domain
PfamPF031063.9E-17169224IPR003657WRKY domain
PROSITE profilePS5081116.111169226IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-32315390IPR003657WRKY domain
PROSITE profilePS5081132.776325390IPR003657WRKY domain
SuperFamilySSF1182904.45E-27326390IPR003657WRKY domain
SMARTSM007742.3E-35330389IPR003657WRKY domain
PfamPF031067.8E-24332388IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MEEDTGIDEA KTYTVEKSEK VEPEKDGLSQ FRDEEKSLGA DMEDLHDETV RETLGKDQVQ  60
GVRENSSVEP NVEDVLEVNE TDSVKETVVS AIVPVDEVEE NRQVETSPSL AASSDSLTVT  120
PCLSLDPATA STAQDLPLVS VPTKQEQRSD SPVVNRLSVT PVPRTPARDG YNWRKYGQKQ  180
VKSPKGSRSY YRCTYTECCA KKIECSNDSG NVVEIVNKGL HTHEPPRKTS FSPREIRVTT  240
AIRPVSEDDT VVEELSIVPS GSDPSASTKE YICESQTLVD RKRHCENEAV EEPEPKRRLK  300
KDNSQSSDSV SKPGKKNKFV VHAAGDVGIC GDGYRWRKYG QKMVKGNPHP RNYYRCTSAG  360
CPVRKHIETA VENTKAVIIT YKGVHNHDMP VPKKRHGPPS SMLVAAAAPT SMRTRTDDQV  420
NIPTSSQCSV GRESEKQSKE ALDVGGEKVM ESARTLLSIG FEIKQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-26317390174WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.317890.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453502120.0
Genevisible253603_at0.0
Expression AtlasAT4G30935-
AtGenExpressAT4G30935-
ATTED-IIAT4G30935-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group I
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G30935.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch P59583
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G30935
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0051100.0BT005110.1 Arabidopsis thaliana clone U20909 putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
GenBankBT0040860.0BT004086.1 Arabidopsis thaliana clone RAFL15-37-C10 (R20909) putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567862.30.0WRKY DNA-binding protein 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLD7MBK50.0D7MBK5_ARALL; Putative uncharacterized protein
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10318610
MalvidsOGEM63382844
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Chang IF, et al.
    Proteomic profiling of tandem affinity purified 14-3-3 protein complexes in Arabidopsis thaliana.
    Proteomics, 2009. 9(11): p. 2967-85
    [PMID:19452453]
  5. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]