PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G29940.1
Common NameF27B13.180, PRH, PRHA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-PHD
Protein Properties Length: 796aa    MW: 90657.3 Da    PI: 4.5722
Description pathogenesis related homeodomain protein A
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G29940.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.57.3e-11462506953
                  HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
     Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                  ++ +e L ++F+++  ps++ r +LAk+l+L+ ++V  WF+N R+
  AT4G29940.1 462 RNAVEKLRQVFAETELPSKAVRDRLAKELSLDPEKVNKWFKNTRY 506
                  678999*************************************97 PP

2PHD41.92.3e-14192247151
                  SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
          PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                  +C+ C++  +  +++++lCd +C+++fH+kCl+++le+e++p g   w+C+ C++k
  AT4G29940.1 192 FCAECNSreAFPDNDIILCDgTCNRAFHQKCLDPPLETESIPPGdqGWFCKFCDCK 247
                  6999***55455********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.29E-14183249IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.3E-12188247IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.976190247IPR019787Zinc finger, PHD-finger
CDDcd155041.75E-32192244No hitNo description
SMARTSM002497.7E-10192245IPR001965Zinc finger, PHD-type
PfamPF006281.6E-11192247IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590193244IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.602.0E-12439505IPR009057Homeodomain-like
SuperFamilySSF466895.99E-11450516IPR009057Homeodomain-like
PROSITE profilePS5007113.313451511IPR001356Homeobox domain
SMARTSM003895.8E-11453515IPR001356Homeobox domain
CDDcd000866.10E-9454506No hitNo description
PfamPF000462.0E-8462506IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006952Biological Processdefense response
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000035anatomycotyledon vascular system
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0002000anatomystomatal complex
PO:0005660anatomyhydathode
PO:0008015anatomyhypocotyl vascular system
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
PO:0009052anatomyflower pedicel
PO:0009066anatomyanther
PO:0009073anatomystigma
PO:0020041anatomystipule
PO:0020100anatomyhypocotyl
PO:0020127anatomyprimary root
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MEESETKGRI SQETDKACVS VERIGSTLLS SFVKKGKEVS NKRNSKQNKR KAEEELCSKS  60
RTKKYSRGWV RCEEMEEEKV KKTRKRKSKR QQKDNKVEVD DSLRLQRRTR YLLIKMKMQQ  120
NLIDAYATEG WKGQSREKIR PDKELERARK EILNCKLGLR DAIRQLDLLS SVGSMEEKVI  180
ASDGSIHHDH IFCAECNSRE AFPDNDIILC DGTCNRAFHQ KCLDPPLETE SIPPGDQGWF  240
CKFCDCKIEI IDTMNAQIGT HFPVDSNWQD IFNEEASLPI GSEATVNNEA DWPSDDSKDD  300
DYDPEMRENG GGNSSNVSGD GGGDNDEESI STSLSLSSDG VALSTGSWEG HRLSNMVEQC  360
ETSNEETVCG PRQRRTVDYT QLYYEMFGKD AVLQEQGSED EDWGPNDRRK RKRESDAGST  420
LVTMCESSKK DQDVVETLEQ SERDSVSVEN KGGRRRMFRL PRNAVEKLRQ VFAETELPSK  480
AVRDRLAKEL SLDPEKVNKW FKNTRYMALR NRKTESVKQP GDSKTVSGGD SGPEAVMENN  540
TETNEVQDTL DDTVPPGFDA TNQNILSPCN NNQEEFQQEN VSFPSPTDES QQYLEQNDSS  600
FVLVPHEKQS SEISLKTAVE ENETESKMMK EPHEELSSEM SLKTAAEEKE TESKMIEEPH  660
EELSREMSLK TAVEEKETES KMMEEPHDEL NSEMSLSTAV EEKETGSKMT EESHEELSNE  720
MSLEEKETGR KMTEEEELEA VMEMLCRTEN KLLDVTQRLD RFKTPKGRKK LGNSSSPLLE  780
EDSVVYVPIA EIKEKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18287TRKRKS
2407412RRKRKR
3452459GRRRMFRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.199830.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO5072190.0
Genevisible253648_at0.0
Expression AtlasAT4G29940-
AtGenExpressAT4G29940-
ATTED-IIAT4G29940-
Functional Description ? help Back to Top
Source Description
TAIRHomeodomain protein (PRHA). Expression of the gene differs in various vegetative and floral plant tissues and is positively influenced by the phytohormone auxin. It is often associated with regions of developing vascular tissue. The prha promoter is highly responsive to the synthetic auxin, naphthalene acetic acid, in transient assays using tobacco protoplasts. The PRHA protein has the capacity to bind to TAATTG core sequence elements but requires additional adjacent bases for high-affinity binding.
UniProtSpecifically binds to the fungal elicitor-responsive DNA element, 5'-CTAATTGTTTA-3', of the gene PR2 promoter.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G29940.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By pathogen infection.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch P48785
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G29940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHPRHA0.0L21991.1 Arabidopsis thaliana homeodomain protein (PRHA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194723.10.0pathogenesis related homeodomain protein A
SwissprotP487850.0PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLA0A178V6K60.0A0A178V6K6_ARATH; PRHA
STRINGAT4G29940.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86992738
Representative plantOGRP18301539
Publications ? help Back to Top
  1. Halbach T,Scheer N,Werr W
    Transcriptional activation by the PHD finger is inhibited through an adjacent leucine zipper that binds 14-3-3 proteins.
    Nucleic Acids Res., 2000. 28(18): p. 3542-50
    [PMID:10982874]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Korfhage U,Trezzini GF,Meier I,Hahlbrock K,Somssich IE
    Plant homeodomain protein involved in transcriptional regulation of a pathogen defense-related gene.
    Plant Cell, 1994. 6(5): p. 695-708
    [PMID:7913642]
  6. Plesch G,Störmann K,Torres JT,Walden R,Somssich IE
    Developmental and auxin-induced expression of the Arabidopsis prha homeobox gene.
    Plant J., 1997. 12(3): p. 635-47
    [PMID:9351248]
  7. Cormack RS,Hahlbrock K,Somssich IE
    Isolation of putative plant transcriptional coactivators using a modified two-hybrid system incorporating a GFP reporter gene.
    Plant J., 1998. 14(6): p. 685-92
    [PMID:9681033]