PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G29000.1
Common NameF19B15.30, TCX5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 603aa    MW: 64635.6 Da    PI: 7.943
Description Tesmin/TSO1-like CXC domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G29000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14129168141
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                  ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  AT4G29000.1 129 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 168
                  589**************************.********986 PP

2TCR50.63.7e-16214253140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  AT4G29000.1 214 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 253
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16129169IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.477130254IPR005172CRC domain
PfamPF036387.6E-11131166IPR005172CRC domain
SMARTSM011141.5E-19214255IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12217252IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MGEDGGGGEF PPKKDGVEEG FPTKKPARQL DFTGGSDEHS LSKPAAPTVV ATSVKPIISS  60
SVPSTIRPGM TIAIGQVTQV RPTLPMATTM SNPPSQSQIV NAPIRHPIPE SPKARGPRPN  120
VEGRDGTPQK KKQCNCKHSR CLKLYCECFA SGTYCDGCNC VNCFNNVDNE PARREAVEAT  180
LERNPFAFRP KIASSPHGGR DKREDIGEVV LLGKHNKGCH CKKSGCLKKY CECFQANILC  240
SENCKCLDCK NFEGSEERQA LFHGEHSNHM AYLQQAANAA ITGAVGSSGF APSPAPKRRK  300
GQEILFNQAI KDSSRLSHFP QVNNGRTGGP TSGTSPSPVS RAGGNASSVP SKFVYRSLLA  360
DIIQPHDVRA LCSVLVTVAG EAAKTSTDKR NEIENRVDDQ TETSLASSAQ DQPQGNNNAA  420
DVEMVATDHN QADKSGPEES NSDGVDASKV TPLSPATLAL MCDEQDTIFM VAAPSPNGSV  480
DPNGCRPNSQ GQSEIYAEQE RLVLTKFRDC LNRLISYAEI KESKCLSLAR MHIQPPAIAT  540
VKTENGIQQQ VPIVNGASRT NCQPTLNKPQ PMQLMNTTSA APATATNTQH LQKPPALSEK  600
KDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-3113126311132Protein lin-54 homolog
5fd3_B3e-3113126311132Protein lin-54 homolog
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.489150.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253750_at0.0
Expression AtlasAT4G29000-
AtGenExpressAT4G29000-
ATTED-IIAT4G29000-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G29000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SZD1
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G29000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194629.10.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A178V2G80.0A0A178V2G8_ARATH; Uncharacterized protein
STRINGAT4G29000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Representative plantOGRP14691745
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Zhang L, et al.
    Conservation of noncoding microsatellites in plants: implication for gene regulation.
    BMC Genomics, 2006. 7: p. 323
    [PMID:17187690]
  5. Andersen SU, et al.
    The conserved cysteine-rich domain of a tesmin/TSO1-like protein binds zinc in vitro and TSO1 is required for both male and female fertility in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(13): p. 3657-70
    [PMID:18057042]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  7. Derkacheva M, et al.
    Arabidopsis MSI1 connects LHP1 to PRC2 complexes.
    EMBO J., 2013. 32(14): p. 2073-85
    [PMID:23778966]