PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G27410.2
Common NameANAC072, F27G19.10, NAC072, RD26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 297aa    MW: 33177.1 Da    PI: 8.9533
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G27410.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.4e-52141391128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrF Ptdeel+v+yL++kv+g +++l +vi ++d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g+
  AT4G27410.2  14 LPPGFRFYPTDEELLVQYLCRKVAGYHFSL-QVIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITA-DGR 109
                  79***************************9.99***************8777899***********************************9999.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   vg+kk Lvfy g+apkg+kt+W+mheyrl
  AT4G27410.2 110 RVGIKKALVFYAGKAPKGTKTNWIMHEYRL 139
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-679162IPR003441NAC domain
PROSITE profilePS5100561.04314162IPR003441NAC domain
PfamPF023655.7E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000258anatomyroot cortex
PO:0000293anatomyguard cell
PO:0003015anatomyprimary root differentiation zone
PO:0005679anatomyepidermis
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGVREKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGYH FSLQVIGDID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITADGRR VGIKKALVFY  120
AGKAPKGTKT NWIMHEYRLI EHSRSHGSSK LDDWVLCRIY KKTSGSQRQA VTPVQACREE  180
HSTNGSSSSS SSQLDDVLDS FPEIKDQSFN LPRMNSLRTI LNGNFDWASL AGLNPIPELA  240
PTNGLPSYGG YDAFRAAEGE AESGHVNRQQ NSSGLTQSFG YSSSGFGVSG QTFEFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-10711687174NAC domain-containing protein 19
3swp_C1e-10711687174NAC domain-containing protein 19
3swp_B1e-10711687174NAC domain-containing protein 19
3swp_A1e-10711687174NAC domain-containing protein 19
3swm_D1e-10711687174NAC domain-containing protein 19
3swm_C1e-10711687174NAC domain-containing protein 19
3swm_B1e-10711687174NAC domain-containing protein 19
3swm_A1e-10711687174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.204120.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253872_at0.0
Expression AtlasAT4G27410-
AtGenExpressAT4G27410-
ATTED-IIAT4G27410-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves and in root pericycle and epidermis. {ECO:0000269|PubMed:15319476, ECO:0000269|PubMed:16581911}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC transcription factor induced in response to dessication. It is localized to the nucleus and acts as a transcriptional activator in ABA-mediated dehydration response.
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Function -- GeneRIF ? help Back to Top
  1. RD26 functions as a transcriptional activator in abscisic acid-inducible gene expression under abiotic stress in plants.
    [PMID: 15341629]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G27410.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G33380(A), AT5G51070(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G13180, AT1G10585, AT1G69600
IntActSearch Q93VY3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G27410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0914280.0AY091428.1 Arabidopsis thaliana unknown protein (At4g27410) mRNA, complete cds.
GenBankAY0575780.0AY057578.1 Arabidopsis thaliana unknown protein (At4g27410) mRNA, complete cds.
GenBankAF4283750.0AF428375.1 Arabidopsis thaliana AT4g27410/F27G19_10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567773.10.0NAC transcription factor RD26
SwissprotQ93VY30.0NAC72_ARATH; NAC domain-containing protein 72
TrEMBLF4JIU90.0F4JIU9_ARATH; NAC transcription factor RD26
STRINGAT4G27410.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Kreps JA, et al.
    Transcriptome changes for Arabidopsis in response to salt, osmotic, and cold stress.
    Plant Physiol., 2002. 130(4): p. 2129-41
    [PMID:12481097]
  3. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Hegedus D, et al.
    Molecular characterization of Brassica napus NAC domain transcriptional activators induced in response to biotic and abiotic stress.
    Plant Mol. Biol., 2003. 53(3): p. 383-97
    [PMID:14750526]
  6. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  7. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  8. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]
  9. Taji T, et al.
    Comparative genomics in salt tolerance between Arabidopsis and aRabidopsis-related halophyte salt cress using Arabidopsis microarray.
    Plant Physiol., 2004. 135(3): p. 1697-709
    [PMID:15247402]
  10. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  11. Tran LS, et al.
    Isolation and functional analysis of Arabidopsis stress-inducible NAC transcription factors that bind to a drought-responsive cis-element in the early responsive to dehydration stress 1 promoter.
    Plant Cell, 2004. 16(9): p. 2481-98
    [PMID:15319476]
  12. Fujita M, et al.
    A dehydration-induced NAC protein, RD26, is involved in a novel ABA-dependent stress-signaling pathway.
    Plant J., 2004. 39(6): p. 863-76
    [PMID:15341629]
  13. Bray EA
    Genes commonly regulated by water-deficit stress in Arabidopsis thaliana.
    J. Exp. Bot., 2004. 55(407): p. 2331-41
    [PMID:15448178]
  14. Sottosanto JB,Gelli A,Blumwald E
    DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression.
    Plant J., 2004. 40(5): p. 752-71
    [PMID:15546358]
  15. Sun K,Cui Y,Hauser BA
    Environmental stress alters genes expression and induces ovule abortion: reactive oxygen species appear as ovules commit to abort.
    Planta, 2005. 222(4): p. 632-42
    [PMID:16133218]
  16. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  17. Fujita Y, et al.
    AREB1 Is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.
    Plant Cell, 2005. 17(12): p. 3470-88
    [PMID:16284313]
  18. Nakashima K, et al.
    Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.
    Plant Mol. Biol., 2006. 60(1): p. 51-68
    [PMID:16463099]
  19. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  20. Thilmony R,Underwood W,He SY
    Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
    Plant J., 2006. 46(1): p. 34-53
    [PMID:16553894]
  21. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  22. Milla MA,Townsend J,Chang IF,Cushman JC
    The Arabidopsis AtDi19 gene family encodes a novel type of Cys2/His2 zinc-finger protein implicated in ABA-independent dehydration, high-salinity stress and light signaling pathways.
    Plant Mol. Biol., 2006. 61(1-2): p. 13-30
    [PMID:16786289]
  23. Rashotte AM, et al.
    A subset of Arabidopsis AP2 transcription factors mediates cytokinin responses in concert with a two-component pathway.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(29): p. 11081-5
    [PMID:16832061]
  24. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  25. Benedict C,Geisler M,Trygg J,Huner N,Hurry V
    Consensus by democracy. Using meta-analyses of microarray and genomic data to model the cold acclimation signaling pathway in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1219-32
    [PMID:16896234]
  26. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  27. Tran LS, et al.
    Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis.
    Plant J., 2007. 49(1): p. 46-63
    [PMID:17233795]
  28. de Torres-Zabala M, et al.
    Pseudomonas syringae pv. tomato hijacks the Arabidopsis abscisic acid signalling pathway to cause disease.
    EMBO J., 2007. 26(5): p. 1434-43
    [PMID:17304219]
  29. Sottosanto JB,Saranga Y,Blumwald E
    Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana.
    BMC Plant Biol., 2007. 7: p. 18
    [PMID:17411438]
  30. Zhang H, et al.
    Rhizobacterial volatile emissions regulate auxin homeostasis and cell expansion in Arabidopsis.
    Planta, 2007. 226(4): p. 839-51
    [PMID:17497164]
  31. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  32. Jung C, et al.
    Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis.
    Plant Physiol., 2008. 146(2): p. 623-35
    [PMID:18162593]
  33. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  34. Giraud E, et al.
    The absence of ALTERNATIVE OXIDASE1a in Arabidopsis results in acute sensitivity to combined light and drought stress.
    Plant Physiol., 2008. 147(2): p. 595-610
    [PMID:18424626]
  35. Krishnaswamy SS, et al.
    Transcriptional profiling of pea ABR17 mediated changes in gene expression in Arabidopsis thaliana.
    BMC Plant Biol., 2008. 8: p. 91
    [PMID:18783601]
  36. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  37. Nakashima K,Ito Y,Yamaguchi-Shinozaki K
    Transcriptional regulatory networks in response to abiotic stresses in Arabidopsis and grasses.
    Plant Physiol., 2009. 149(1): p. 88-95
    [PMID:19126699]
  38. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  39. Delage E,Ruelland E,Guillas I,Zachowski A,Puyaubert J
    Arabidopsis type-III phosphatidylinositol 4-kinases β1 and β2 are upstream of the phospholipase C pathway triggered by cold exposure.
    Plant Cell Physiol., 2012. 53(3): p. 565-76
    [PMID:22318862]
  40. Kim MJ, et al.
    Controlled nuclear import of the transcription factor NTL6 reveals a cytoplasmic role of SnRK2.8 in the drought-stress response.
    Biochem. J., 2012. 448(3): p. 353-63
    [PMID:22967043]
  41. Hickman R, et al.
    A local regulatory network around three NAC transcription factors in stress responses and senescence in Arabidopsis leaves.
    Plant J., 2013. 75(1): p. 26-39
    [PMID:23578292]
  42. Singh AK,Sharma V,Pal AK,Acharya V,Ahuja PS
    Genome-wide organization and expression profiling of the NAC transcription factor family in potato (Solanum tuberosum L.).
    DNA Res., 2013. 20(4): p. 403-23
    [PMID:23649897]
  43. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  44. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]