PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G26440.1
Common NameATWRKY34, M3E9.130, MSP3, WRKY34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 568aa    MW: 62166.7 Da    PI: 6.0412
Description WRKY DNA-binding protein 34
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G26440.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.31.2e-31178234259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  dDgynWrKYGqK vkgse+prsYY+Ct+++C++kkkvers+ +++++ei+Y+g+H h+
  AT4G26440.1 178 DDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEAKKKVERSR-EGHIIEIIYTGDHIHS 234
                  8****************************************.***************8 PP

2WRKY99.42.2e-31371428158
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v +tY g+H+h
  AT4G26440.1 371 LDDGYRWRKYGQKVVKGNPNPRSYYKCTANGCTVTKHVERASDDFKSVLTTYIGKHTH 428
                  59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.02172236IPR003657WRKY domain
SuperFamilySSF1182901.57E-24175236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-27175236IPR003657WRKY domain
SMARTSM007741.3E-34177235IPR003657WRKY domain
PfamPF031063.5E-24178233IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.4E-34356431IPR003657WRKY domain
SuperFamilySSF1182901.83E-27363431IPR003657WRKY domain
PROSITE profilePS5081134.578366431IPR003657WRKY domain
SMARTSM007747.2E-36371430IPR003657WRKY domain
PfamPF031063.9E-24372428IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009555Biological Processpollen development
GO:0009846Biological Processpollen germination
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009046anatomyflower
PO:0009066anatomyanther
PO:0025195anatomypollen tube cell
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MAGIDNKAAV MGEWFDCSTT NHRKRSKAEL GREFSLNYIK NEDSLQTTFQ ESSRGALRER  60
IAARSGFNAP WLNTEDILQS KSLTISSPGL SPATLLESPV FLSNPLLSPT TGKLSSVPSD  120
KAKAELFDDI TTSLAFQTIS GSGLDPTNIA LEPDDSQDYE ERQLGGLGDS MACCAPADDG  180
YNWRKYGQKL VKGSEYPRSY YKCTHPNCEA KKKVERSREG HIIEIIYTGD HIHSKPPPNR  240
RSGIGSSGTG QDMQIDATEY EGFAGTNENI EWTSPVSAEL EYGSHSGSMQ VQNGTHQFGY  300
GDAAADALYR DENEDDRTSH MSVSLTYDGE VEESESKRRK LEAYATETSG STRASREPRV  360
VVQTTSDIDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTAN GCTVTKHVER ASDDFKSVLT  420
TYIGKHTHVV PAARNSSHVG AGSSGTLQGS LATQTHNHNV HYPMPHSRSE GLATANSSLF  480
DFQSHLRHPT GFSVYIGQSE LSDLSMPGLT IGQEKLTSLQ APDIGDPTGL MLQLAAQPKV  540
EPVSPQQGLD LSASSLICRE MLSRLRQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-31178432878Probable WRKY transcription factor 4
2lex_A2e-31178432878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453452540.0
Genevisible253961_at0.0
Expression AtlasAT4G26440-
AtGenExpressAT4G26440-
ATTED-IIAT4G26440-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group I
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Function -- GeneRIF ? help Back to Top
  1. the WRKY34 transcription factor negatively mediated cold sensitivity of mature Arabidopsis pollen and might be involved in the CBF signal cascade in mature pollen.
    [PMID: 20643804]
  2. Loss of MPK3/MPK6 phosphorylation sites in WRKY34 compromises the function of WRKY34 in vivo
    [PMID: 24830428]
  3. The study provides evidence that VQ20 acts as a key partner of WRKY2 and WKRY34 in plant male gametogenesis.
    [PMID: 28635025]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G26440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G26440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0526490.0AY052649.1 Arabidopsis thaliana WRKY transcription factor 34 (WRKY34) mRNA, complete cds.
GenBankBT0303610.0BT030361.1 Arabidopsis thaliana At4g26440 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194374.10.0WRKY DNA-binding protein 34
SwissprotO655900.0WRK34_ARATH; Probable WRKY transcription factor 34
TrEMBLA4FVR30.0A4FVR3_ARATH; At4g26440
STRINGAT4G26440.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141811524
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  4. Honys D, et al.
    Identification of microspore-active promoters that allow targeted manipulation of gene expression at early stages of microgametogenesis in Arabidopsis.
    BMC Plant Biol., 2006. 6: p. 31
    [PMID:17184530]
  5. Hammargren J,Rosenquist S,Jansson C,Knorpp C
    A novel connection between nucleotide and carbohydrate metabolism in mitochondria: sugar regulation of the Arabidopsis nucleoside diphosphate kinase 3a gene.
    Plant Cell Rep., 2008. 27(3): p. 529-34
    [PMID:18057937]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  7. Capron A, et al.
    Maternal control of male-gamete delivery in Arabidopsis involves a putative GPI-anchored protein encoded by the LORELEI gene.
    Plant Cell, 2008. 20(11): p. 3038-49
    [PMID:19028964]
  8. Zou C,Jiang W,Yu D
    Male gametophyte-specific WRKY34 transcription factor mediates cold sensitivity of mature pollen in Arabidopsis.
    J. Exp. Bot., 2010. 61(14): p. 3901-14
    [PMID:20643804]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  10. Guan Y, et al.
    Phosphorylation of a WRKY transcription factor by MAPKs is required for pollen development and function in Arabidopsis.
    PLoS Genet., 2014. 10(5): p. e1004384
    [PMID:24830428]
  11. Hu X, et al.
    Proteasome-mediated degradation of FRIGIDA modulates flowering time in Arabidopsis during vernalization.
    Plant Cell, 2014. 26(12): p. 4763-81
    [PMID:25538183]
  12. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]