PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G26170.1
Common NameET1, F20B18.280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HRT-like
Protein Properties Length: 506aa    MW: 57002.7 Da    PI: 9.3423
Description
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G26170.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like58.31.3e-18306334230
     HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                  CGv+ledG++C+++PvkgRKRC eHKG+R
  AT4G26170.1 306 CGVLLEDGTTCTTTPVKGRKRCTEHKGKR 334
                  ****************************9 PP

2HRT-like46.27.6e-15360390131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  iCGvil d + C+ +Pv  RKRCe HKGmR+
  AT4G26170.1 360 ICGVILPDMIRCRSKPVSRRKRCEDHKGMRV 390
                  8*****************************7 PP

3HRT-like31.13.9e-10428455229
     HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGm 29 
                  C +++++G +C+r++ +g KRC++HK++
  AT4G26170.1 428 CEATTKNGLPCTRSAPEGSKRCWQHKDK 455
                  9*************************86 PP

4HRT-like63.72.6e-20474504131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  iCG++l +GsvC+++PvkgRKRCeeHKGmRi
  AT4G26170.1 474 ICGFKLYNGSVCEKSPVKGRKRCEEHKGMRI 504
                  8*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MLVVLQIHSS INVKVFASRL RKHFFFTRRK ITRIATCLSS SRCPLYPSHW NLCRWNNKQG  60
GTEIGLLIGG LIVFRQTLKS DQETKREQKK RDWILVTAFP SPSCSPCSRE TTTFELIMTP  120
FFQSGRVSPD LCFCVNPFQK LQNSQDFCGL LLNFSRFRSK AKGANEKENF REGKDLVGRN  180
RVQGAFQGLY ELSHDHGRKD DVLVANLGQP ESIRSRLRSY SRSFAHHDLL KQGLSQTILP  240
TTQNKSDNQT EEKKSDSEEE REVSSDAAEK ESNSLPSILR LSRSRPQPVS EKHDDIVDES  300
DSASACGVLL EDGTTCTTTP VKGRKRCTEH KGKRLSRVSP GIHIPCEVPT VRECEETENI  360
CGVILPDMIR CRSKPVSRRK RCEDHKGMRV NAFFFLLNPT ERDKAVNEDK SKPETSTGMN  420
QEGSGLLCEA TTKNGLPCTR SAPEGSKRCW QHKDKTLNHG SSENVQSATA SQVICGFKLY  480
NGSVCEKSPV KGRKRCEEHK GMRITS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402560690.0
Genevisible254017_at1e-172
Expression AtlasAT4G26170-
AtGenExpressAT4G26170-
ATTED-IIAT4G26170-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in rosette leaves, stipules, stems, flowers, siliques and mature seeds. Expressed in the vascular bundles of xylem in shoot parenchyma cells. Expressed in the remnant cytoplasm of differentiated fiber cells and in protoxylem element of parenchymal cells. {ECO:0000269|PubMed:17991462}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in the regulation of cell differentiation in meristems (By similarity). Binds DNA without sequence preference (PubMed:22226340). {ECO:0000250|UniProtKB:F4K933, ECO:0000269|PubMed:22226340}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G26170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G26170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1615640.0AL161564.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 64.
GenBankAL0494830.0AL049483.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F20B18 (ESSA project).
GenBankAL0491710.0AL049171.1 Arabidopsis thaliana DNA chromosome 4, BAC clone (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194347.40.0uncharacterized protein
SwissprotF4JU690.0ET1_ARATH; Protein EFFECTOR OF TRANSCRIPTION 1
TrEMBLD7MFC20.0D7MFC2_ARALL; Putative uncharacterized protein
STRINGAT4G26170.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP52481420
MalvidsOGEM29542763
Publications ? help Back to Top
  1. Ellerstr
    Ectopic expression of EFFECTOR OF TRANSCRIPTION perturbs gibberellin-mediated plant developmental processes.
    Plant Mol. Biol., 2005. 59(4): p. 663-81
    [PMID:16244914]
  2. Ivanov R, et al.
    EFFECTOR OF TRANSCRIPTION2 is involved in xylem differentiation and includes a functional DNA single strand cutting domain.
    Dev. Biol., 2008. 313(1): p. 93-106
    [PMID:17991462]
  3. Ivanov R,Tiedemann J,Czihal A,Baumlein H
    Transcriptional regulator AtET2 is required for the induction of dormancy during late seed development.
    J. Plant Physiol., 2012. 169(5): p. 501-8
    [PMID:22226340]