PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G24660.1
Common NameATHB22, F22K18.140, HB22, MEE68, ZHD2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 220aa    MW: 24022.8 Da    PI: 8.0189
Description homeobox protein 22
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G24660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.39e-3446100358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  k+rY+eClkNhA+++GghavDGC+Efmps ge+gt +alkCaACgCHRnFHR+e+e
  AT4G24660.1  46 KIRYRECLKNHAVNIGGHAVDGCCEFMPS-GEDGTLDALKCAACGCHRNFHRKETE 100
                  79**************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047708.8E-314799IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-2747101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-294898IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.3664998IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.8E-32144219IPR009057Homeodomain-like
SuperFamilySSF466891.9E-20145218IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-27158214IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MNFEDQEEDM EMSGVNPPCG YDSLSGEGAT SSGGGGVGRS KGVGAKIRYR ECLKNHAVNI  60
GGHAVDGCCE FMPSGEDGTL DALKCAACGC HRNFHRKETE SIGGRAHRVP TYYNRPPQPH  120
QPPGYLHLTS PAAPYRPPAA SGDEEDTSNP SSSGGTTKRF RTKFTAEQKE KMLAFAERLG  180
WRIQKHDDVA VEQFCAETGV RRQVLKIWMH NNKNSLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-45148215875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.25430.0cell culture| inflorescence
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254132_at0.0
Expression AtlasAT4G24660-
AtGenExpressAT4G24660-
ATTED-IIAT4G24660-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and, to a lower extent, in inflorescence, stems and leaves. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtEssential protein. Putative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G24660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SB61
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Arrested at early embryo stages. {ECO:0000269|PubMed:15634699}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G24660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAY1255630.0AY125563.1 Arabidopsis thaliana AT4g24660/F22K18_140 mRNA, complete cds.
GenBankAL1615610.0AL161561.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 61.
GenBankAL0353560.0AL035356.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F22K18 (ESSAII project).
GenBankAF4398410.0AF439841.1 Arabidopsis thaliana AT4g24660/F22K18_140 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194197.11e-166ZF-HD homeobox protein
SwissprotQ9SB611e-168ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLR0FAW71e-127R0FAW7_9BRAS; Uncharacterized protein
STRINGAT4G24660.11e-166(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MalvidsOGEM45052454
Publications ? help Back to Top
  1. Windhövel A,Hein I,Dabrowa R,Stockhaus J
    Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia.
    Plant Mol. Biol., 2001. 45(2): p. 201-14
    [PMID:11289511]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Pagnussat GC, et al.
    Genetic and molecular identification of genes required for female gametophyte development and function in Arabidopsis.
    Development, 2005. 132(3): p. 603-14
    [PMID:15634699]
  4. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  5. Yadav SR,Prasad K,Vijayraghavan U
    Divergent regulatory OsMADS2 functions control size, shape and differentiation of the highly derived rice floret second-whorl organ.
    Genetics, 2007. 176(1): p. 283-94
    [PMID:17409064]
  6. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  7. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  8. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]
  9. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]