PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G24150.1
Common NameAtGRF8, GRF8, T19F6.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRF
Protein Properties Length: 493aa    MW: 54608.7 Da    PI: 6.9262
Description growth-regulating factor 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G24150.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.46.1e-24244287245
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                   ep+rC+RtDGKkWRCsr+v++++k+CErH h++r rsrk++e+
  AT4G24150.1 244 LEPWRCKRTDGKKWRCSRNVIPDQKYCERHTHKSRPRSRKHVES 287
                  69***************************************997 PP

2QLQ52.71.3e-18149183236
          QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                  aF+ aQ+++L++Q  +yKy++a++PvPpeLl + +
  AT4G24150.1 149 AFSEAQWHELERQRNIYKYMMASVPVPPELLTPFP 183
                  8******************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.8E-12148184IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.4E-12149181IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.784149184IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.842243287IPR014977WRC domain
PfamPF088791.3E-19245286IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0019222Biological Processregulation of metabolic process
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020144anatomyapical meristem
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MRMLLGIPYV DKSVLSNSVL ERGKQDKSKL LLVDKCHYEL DVEERKEDFV GGFGFGVVEN  60
SHKDVMVLPH HHYYPSYSSP SSSSLCYCSA GVSDPMFSVS SNQAYTSSHS GMFTPAGSGS  120
AAVTVADPFF SLSSSGEMRR SMNEDAGAAF SEAQWHELER QRNIYKYMMA SVPVPPELLT  180
PFPKNHQSNT NPDVDTYRSG MFSIYADYKN LPLSMWMTVT VAVATGGSLQ LGIASSASNN  240
TADLEPWRCK RTDGKKWRCS RNVIPDQKYC ERHTHKSRPR SRKHVESSHQ SSHHNDIRTA  300
KNDTSQLVRT YPQFYGQPIS QIPVLSTLPS ASSPYDHHRG LRWFTKEDDA IGTLNPETQE  360
AVQLKVGSSR ELKRGFDYDL NFRQKEPIVD QSFGALQGLL SLNQTPQHNQ ETRQFVVEGK  420
QDEAMGSSLT LSMAGGGMEE TEGTNQHQWV SHEGPSWLYS TTPGGPLAEA LCLGVSNNPS  480
SSTTTSSCSR SSS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.512400.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184162850.0
Genevisible254203_at0.0
Expression AtlasAT4G24150-
AtGenExpressAT4G24150-
ATTED-IIAT4G24150-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in shoot tips and flowers. {ECO:0000269|PubMed:12974814}.
Functional Description ? help Back to Top
Source Description
TAIRGrowth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development and expressed in shoot and flower.
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G24150.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G24150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATAC0023430.0AC002343.1 Arabidopsis thaliana chromosome IV BAC T19F6 genomic sequence, complete sequence.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1615610.0AL161561.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 61.
GenBankAL1096190.0AL109619.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T19F6, partial sequence (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194146.10.0growth-regulating factor 8
SwissprotQ9SU440.0GRF8_ARATH; Growth-regulating factor 8
TrEMBLR0H2280.0R0H228_9BRAS; Uncharacterized protein
STRINGAT4G24150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
MalvidsOGEM78362637
Publications ? help Back to Top
  1. Froehlich JE, et al.
    Proteomic study of the Arabidopsis thaliana chloroplastic envelope membrane utilizing alternatives to traditional two-dimensional electrophoresis.
    J. Proteome Res., 2003 Jul-Aug. 2(4): p. 413-25
    [PMID:12938931]
  2. Kim JH,Choi D,Kende H
    The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis.
    Plant J., 2003. 36(1): p. 94-104
    [PMID:12974814]
  3. Jones-Rhoades MW,Bartel DP
    Computational identification of plant microRNAs and their targets, including a stress-induced miRNA.
    Mol. Cell, 2004. 14(6): p. 787-99
    [PMID:15200956]
  4. Kim JH,Kende H
    A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9
    [PMID:15326298]
  5. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  6. Liu D,Song Y,Chen Z,Yu D
    Ectopic expression of miR396 suppresses GRF target gene expression and alters leaf growth in Arabidopsis.
    Physiol Plant, 2009. 136(2): p. 223-36
    [PMID:19453503]
  7. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  8. Liang G,He H,Li Y,Wang F,Yu D
    Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 249-58
    [PMID:24285851]