PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G21080.1
Common NameAtDOF4.5, DOF4.5, F7J7.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 249aa    MW: 28094 Da    PI: 8.4678
Description Dof-type zinc finger domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G21080.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.35.2e-362480561
       zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  + c+rCds+ntkfCyynny+  qPryfCk+CrryWt+GGalrn+P+Gg++r ++++
  AT4G21080.1 24 PRVCARCDSDNTKFCYYNNYCEFQPRYFCKNCRRYWTHGGALRNIPIGGSSRAKRAR 80
                 578*************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.8E-282578IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-272578IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.4032579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDNLNVFANE DNQVNDVKPP PPPPRVCARC DSDNTKFCYY NNYCEFQPRY FCKNCRRYWT  60
HGGALRNIPI GGSSRAKRAR VNQPSVARMV SVETQRGNNQ PFSNVQENVH LVGSFGASSS  120
SSVGAVGNLF GSLYDIHGGM VTNLHPTRTV RPNHRLAFHD GSFEQDYYDV GSDNLLVNQQ  180
VGGYGYHMNP VDQFKWNQSF NNTMNMNYNN DSTSGSSRGS DMNVNHDNKK IRYRNSVIMH  240
PCHLEKDGP
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254450_at0.0
Expression AtlasAT4G21080-
AtGenExpressAT4G21080-
ATTED-IIAT4G21080-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00446DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G21080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G21080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0219600.0AL021960.2 Arabidopsis thaliana DNA chromosome 4, BAC clone F7J7 (ESSA project).
GenBankAL1615540.0AL161554.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 54.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193840.10.0Dof-type zinc finger domain-containing protein
SwissprotO495500.0DOF45_ARATH; Dof zinc finger protein DOF4.5
TrEMBLA0A178V5F10.0A0A178V5F1_ARATH; DOF4.5
STRINGAT4G21080.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  6. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  7. Zou HF, et al.
    The transcription factor AtDOF4.2 regulates shoot branching and seed coat formation in Arabidopsis.
    Biochem. J., 2013. 449(2): p. 373-88
    [PMID:23095045]