PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G21050.1
Common NameAtDOF4.4, DOF4.4, T13K14.210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 210aa    MW: 23969.5 Da    PI: 6.0048
Description Dof-type zinc finger domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G21050.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.72.2e-372279461
       zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  ++ cprCds+ntkfC+ynnys sqPryfCk+CrryWt+GGalrn+PvGg++rk k+ 
  AT4G21050.1 22 PSRVCPRCDSDNTKFCFYNNYSESQPRYFCKNCRRYWTHGGALRNIPVGGSCRKPKRL 79
                 5678**************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-321778IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2392478IPR003851Zinc finger, Dof-type
PfamPF027017.4E-322478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010154Biological Processfruit development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MDNLNVFANE DNQVNGLKRP PPSRVCPRCD SDNTKFCFYN NYSESQPRYF CKNCRRYWTH  60
GGALRNIPVG GSCRKPKRLK VDQSSISEMV SVENQPINHQ SFRQTQENNE FVRSFDASSS  120
ATVTAVPNHF GYLSELHGVT NLLPIQSFRT MDCLDFGDES FQQGYYDVGS NDLIDNPLIN  180
QSIGGYVDNL TSYCINQVEP KLQPRYEHES
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254441_at0.0
Expression AtlasAT4G21050-
AtGenExpressAT4G21050-
ATTED-IIAT4G21050-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G21050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G21050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0802820.0AL080282.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T13K14 (ESSA project).
GenBankAL1615540.0AL161554.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 54.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193837.11e-157Dof-type zinc finger domain-containing protein
SwissprotQ9SUA91e-158DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A178UXJ91e-146A0A178UXJ9_ARATH; DOF4.4
STRINGAT4G21050.11e-156(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Schluepmann H, et al.
    Trehalose mediated growth inhibition of Arabidopsis seedlings is due to trehalose-6-phosphate accumulation.
    Plant Physiol., 2004. 135(2): p. 879-90
    [PMID:15181209]
  6. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  7. Zou HF, et al.
    The transcription factor AtDOF4.2 regulates shoot branching and seed coat formation in Arabidopsis.
    Biochem. J., 2013. 449(2): p. 373-88
    [PMID:23095045]