PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G21040.1
Common NameAtDOF4.3, DOF4.3, T13K14.200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 232aa    MW: 26075.6 Da    PI: 8.4692
Description Dof-type zinc finger domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G21040.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.81.7e-362480561
       zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  + c+rCds+ntkfCyynnys  qPryfCk+CrryWt+GGalrnvP+Gg++r ++++
  AT4G21040.1 24 PRVCARCDSDNTKFCYYNNYSEFQPRYFCKNCRRYWTHGGALRNVPIGGSSRAKRTR 80
                 578*************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.6E-302578IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-272578IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.7672579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MDNFNVVANE DNQVNDVKPP PPPPRVCARC DSDNTKFCYY NNYSEFQPRY FCKNCRRYWT  60
HGGALRNVPI GGSSRAKRTR INQPSVAQMV SVGIQPGSHK PFFNVQENND FVGSFGASSS  120
SFVAAVGNRF SSLSHIHGGM VTNVHPTQTF RPNHRLAFHN GSFEQDYYDV GSDNLLVNQQ  180
VGGYVDNHNG YHMNQVDQYN WNQSFNNAMN MNYNNASTSG RMHPSHLEKG GP
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G21040
AtGenExpressAT4G21040
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00116ampDAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G21040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G21040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0802820.0AL080282.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T13K14 (ESSA project).
GenBankAL1615540.0AL161554.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 54.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193836.11e-173Dof-type zinc finger domain-containing protein
SwissprotQ9SUB01e-174DOF43_ARATH; Dof zinc finger protein DOF4.3
TrEMBLA0A178UUE01e-172A0A178UUE0_ARATH; DOF4.3
STRINGAT4G21040.11e-173(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  6. Zou HF, et al.
    The transcription factor AtDOF4.2 regulates shoot branching and seed coat formation in Arabidopsis.
    Biochem. J., 2013. 449(2): p. 373-88
    [PMID:23095045]
  7. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]