PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G21030.1
Common NameATDOF4;2, ATDOF4.2, DOF4.2, T13K14.190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 194aa    MW: 22107.6 Da    PI: 5.5667
Description Dof-type zinc finger domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G21030.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof734.1e-232174659
       zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                 + cprC s++t+f y+nn   sqPry Ck+C r Wt+GG lrn+Pv g + k++
  AT4G21030.1 21 RVCPRCYSDQTRFSYFNNNKKSQPRYKCKNCCRCWTHGGVLRNIPVTGICDKSN 74
                 68**********************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-271973IPR003851Zinc finger, Dof-type
PfamPF027017.2E-222173IPR003851Zinc finger, Dof-type
PROSITE profilePS5088422.5832175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048359Biological Processmucilage metabolic process involved in seed coat development
GO:0048825Biological Processcotyledon development
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MNNLNVFTNE DNEMNVMPPP RVCPRCYSDQ TRFSYFNNNK KSQPRYKCKN CCRCWTHGGV  60
LRNIPVTGIC DKSNLPKIDQ SSVSQMILAE IQQGNHQPFK KFQENISVSV SSSSDVSIVG  120
NHFDDLSELH GITNSTPIRS FTMDRLDFGE ESFQQDLYDV GSNDLIGNPL INQSIGGYVD  180
NHKDEHKLQF EYES
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G21030
AtGenExpressAT4G21030
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Data indicate that AtDOF4.2-overexpressing increased branching through the up-regulation of three branching-related genes, AtSTM (SHOOT MERISTEMLESS), AtTFL1 (TERMINAL FLOWER1) and AtCYP83B1 (CYTOCHROME P450 83B1).
    [PMID: 23095045]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00445DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G21030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G21030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0802820.0AL080282.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T13K14 (ESSA project).
GenBankAL1615540.0AL161554.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 54.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193835.11e-144Dof-type zinc finger domain-containing protein
SwissprotQ9SUB11e-145DOF42_ARATH; Dof zinc finger protein DOF4.2
TrEMBLD7MFF91e-92D7MFF9_ARALL; Uncharacterized protein
STRINGAT4G21030.11e-143(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  6. Skirycz A, et al.
    Transcription factor AtDOF4;2 affects phenylpropanoid metabolism in Arabidopsis thaliana.
    New Phytol., 2007. 175(3): p. 425-38
    [PMID:17635218]
  7. Zou HF, et al.
    The transcription factor AtDOF4.2 regulates shoot branching and seed coat formation in Arabidopsis.
    Biochem. J., 2013. 449(2): p. 373-88
    [PMID:23095045]