PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G20970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bHLH
Protein Properties Length: 190aa    MW: 21576.6 Da    PI: 7.3682
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G20970.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH35.61.7e-111764655
                 HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                 + +E++RR +++s ++eL +llP+    + + l+  + L +A +YIk+Lq
  AT4G20970.1 17 KTVEKNRRMQMKSLYSELISLLPHH--SSTEPLTLPDQLDEAANYIKKLQ 64
                 789*********************6..16666*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.5851163IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.05E-51168No hitNo description
SuperFamilySSF474593.73E-101679IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.5E-91678IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000109.4E-71764IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.00231769IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0050832Biological Processdefense response to fungus
GO:0090575Cellular ComponentRNA polymerase II transcription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MEPSHSNTGQ SRSVDRKTVE KNRRMQMKSL YSELISLLPH HSSTEPLTLP DQLDEAANYI  60
KKLQVNVEKK RERKRNLVAT TTLEKLNSVG SSSVSSSVDV SVPRKLPKIE IQETGSIFHI  120
FLVTSLEHKF MFCEIIRVLT EELGAEITHA GYSIVDDAVF HTLHCKVEEH DYGARSQIPE  180
RLEKIVNSVH
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO223288370.0
Expression AtlasAT4G20970-
AtGenExpressAT4G20970-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G20970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G20970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936860.0AB493686.1 Arabidopsis thaliana At4g20970 mRNA for hypothetical protein, partial cds, clone: RAAt4g20970.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193829.21e-138basic helix-loop-helix (bHLH) DNA-binding superfamily protein
SwissprotF4JIJ71e-139BH162_ARATH; Transcription factor bHLH162
TrEMBLA0A178UYG11e-136A0A178UYG1_ARATH; Uncharacterized protein
STRINGAT4G20970.11e-137(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12782592
Representative plantOGRP13451147
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Heim MA, et al.
    The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity.
    Mol. Biol. Evol., 2003. 20(5): p. 735-47
    [PMID:12679534]
  3. Bailey PC, et al.
    Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana.
    Plant Cell, 2003. 15(11): p. 2497-502
    [PMID:14600211]
  4. Huibers RP,de Jong M,Dekter RW,Van den Ackerveken G
    Disease-specific expression of host genes during downy mildew infection of Arabidopsis.
    Mol. Plant Microbe Interact., 2009. 22(9): p. 1104-15
    [PMID:19656045]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]